WormBase Tree Display for Antibody: WBAntibody00001151
expand all nodes | collapse all nodes | view schema
| WBAntibody00001151 | Summary | Rat polyclonal peptide antibody against SPCH-1 (C04G2.8), SPCH-2 (C10G11.9), and SPCH-3 (T27A3.4). | ||
|---|---|---|---|---|
| Public_name | [WBPaper00028451]:spch-1/2/3_c | |||
| Other_name | 1340 | |||
| Gene | WBGene00007307 | |||
| WBGene00015689 | ||||
| WBGene00020840 | ||||
| Isolation | Original_publication | WBPaper00028451 | ||
| Location | TY | |||
| Clonality | Polyclonal | |||
| Antigen | Peptide | Anti-SPCH-1 (C04G2.8), SPCH-2 (C10G11.9), and SPCH-3 (T27A3.4) rat (animals 1340) antibody was raised and affinity purified against the N-terminal peptide MPKSKSQKNKLRPRDSKGRFTPLADADRTV with a C-terminal cysteine linker. | ||
| Animal | Rat | |||
| Expr_pattern | Expr4212 | |||
| Reference | WBPaper00028451 |
