WormBase Tree Display for Variation: WBVar00088385
expand all nodes | collapse all nodes | view schema
WBVar00088385 | Evidence | Person_evidence | WBPerson9765 | ||||||
---|---|---|---|---|---|---|---|---|---|
Name | Public_name | ky5 | |||||||
Other_name | ZK512.6a.1:c.15_326del | ||||||||
CE01109:p.Glu6_Ter109delextTer? | |||||||||
HGVSg | CHROMOSOME_III:g.9136930_9137543del | ||||||||
Sequence_details | SMap | S_parent | Sequence | ZK512 | |||||
Flanking_sequences | TCATTTTCAGAAACCATGTCGTCATGGAA | TGTAAGACACGATAAAAAAATTATGCAAAA | |||||||
Mapping_target | ZK512 | ||||||||
Type_of_mutation | Deletion | ||||||||
SeqStatus | Sequenced | ||||||||
Variation_type | Allele | ||||||||
Origin | Species | Caenorhabditis elegans | |||||||
Strain | WBStrain00005282 | ||||||||
WBStrain00005551 | |||||||||
WBStrain00005552 | |||||||||
WBStrain00005553 | |||||||||
WBStrain00027259 | |||||||||
Laboratory | CX | ||||||||
Status | Live | ||||||||
Affects | Gene | WBGene00001135 | |||||||
Transcript | ZK512.6b.1 | VEP_consequence | splice_acceptor_variant,splice_donor_variant,coding_sequence_variant,5_prime_UTR_variant,intron_variant | ||||||
VEP_impact | HIGH | ||||||||
cDNA_position | ?-263 | ||||||||
CDS_position | ?-263 | ||||||||
Protein_position | ?-88 | ||||||||
Intron_number | 1/10 | ||||||||
Exon_number | 1-2/11 | ||||||||
ZK512.6a.1 | VEP_consequence | splice_acceptor_variant,splice_donor_variant,stop_lost,protein_altering_variant,intron_variant | |||||||
VEP_impact | HIGH | ||||||||
HGVSc | ZK512.6a.1:c.15_326del | ||||||||
HGVSp | CE01109:p.Glu6_Ter109delextTer? | ||||||||
cDNA_position | 44-355 | ||||||||
CDS_position | 15-326 | ||||||||
Protein_position | 5-109 | ||||||||
Intron_number | 2-3/13 | ||||||||
Exon_number | 2-4/14 | ||||||||
Codon_change | aaCGAGGCTTGGGATCGTGGCAAACAAATGGTTGGAGAGCCACTCGCCAAGTGAGTTTCTTTTGAGATTTTTTGTCCACCATTTCCGGAGCCCAACACAACAAAAAGGCACACGGCCGTGAAATTGGTGGGGCTGAATGAGCGCACATACCTCTCAAGCATTAACATTTTTTTCGATTCCATATCTCAACTAATTTCAGAATGACTGCAGCAGCTGCATCTGCAACTGGTGCAGCACCCCCACAGCAAATGTAAGTGTATAAAGAGCAGGTGGATTTTTAAATCTATAGATATCAGATCGAATTTGTTCTTGATTGATAGTGAACATCTAGTAAACTTTTGCCACAACTATTTTTCAAAATTAAAATTTTTCCAAACCTTTTTCAAGAAAAAAACAATTTCAGGCAAGAAGAAGGAAACGAAAACCCGATGCAAATGCATTCAAACAAAGTGCTTCAAGTTATGGAGCAAACTTGGATCGGAAAATGCCGAAAACGTTGGCTTCTAGCTATTCTTGCAAATATGGGATTCATGATTTCATTTGGAATTCGATGCAATTTCGGTGCAGCCAAAACTCATATGTATAAAAATTATACAGATCCATACGGAAAAGTTCAt/aat | ||||||||
Amino_acid_change | NEAWDRGKQMVGEPLAK*VSFEIFCPPFPEPNTTKRHTAVKLVGLNERTYLSSINIFFDSISQLISE*LQQLHLQLVQHPHSKCKCIKSRWIFKSIDIRSNLFLIDSEHLVNFCHNYFSKLKFFQTFFKKKTISGKKKETKTRCKCIQTKCFKLWSKLGSENAENVGF*LFLQIWDS*FHLEFDAISVQPKLICIKIIQIHTEKFX/N | ||||||||
Interactor | WBInteraction000578897 | ||||||||
WBInteraction000578898 | |||||||||
WBInteraction000578899 | |||||||||
Genetics | Interpolated_map_position | III | 0.17242 | ||||||
Description | Phenotype (14) | ||||||||
Phenotype_not_observed | WBPhenotype:0000006 | Paper_evidence | WBPaper00032082 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | All these animals retained a similar number of eggs when compared to wild-type animals (~10 eggs). | Paper_evidence | WBPaper00032082 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Phenotype_assay | Treatment | Young well-fed animals were scored | Paper_evidence | WBPaper00032082 | |||||
Curator_confirmed | WBPerson712 | ||||||||
Temperature | 25 | Paper_evidence | WBPaper00032082 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000631 | Paper_evidence | WBPaper00035198 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Animals do not exhibit anterior convulsions when treated with pentylenetetrazole(PTZ). | Paper_evidence | WBPaper00035198 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Affected_by | Molecule | WBMol:00004251 | Paper_evidence | WBPaper00035198 | |||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000643 | Paper_evidence | WBPaper00038117 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | eat-4(ky5) mutants did not show locomotion defects. | Paper_evidence | WBPaper00038117 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0001182 | Paper_evidence | WBPaper00032082 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Fat levels were similar to that seen in wild-type but are reduced when compared to daf-7(e1375) as determined by Sudan Black assay (described in Kimura et al., 1997). | Paper_evidence | WBPaper00032082 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Phenotype_assay | Treatment | To minimize staining variability, which allowed for quantitative comparisons between various genotypes: animals from one genotype were labeled with fluorescein isothiocyanate (FITC) and then fixed and stained in the same tube as unlabeled animals from another genotype. | Paper_evidence | WBPaper00032082 | |||||
Curator_confirmed | WBPerson712 | ||||||||
Temperature | 22 | Paper_evidence | WBPaper00032082 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0001291 | Paper_evidence | WBPaper00038117 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Animals dispersed less than wild-type animals in the absence of a temperature gradient. | Paper_evidence | WBPaper00038117 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0001765 | Paper_evidence | WBPaper00031936 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | Mutants defective in the synthesis and reception of nonessential excitatory neurotransmitters respond normally to CO2 | Paper_evidence | WBPaper00031936 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
EQ_annotations | Life_stage | WBls:0000057 | PATO:0000460 | Paper_evidence | WBPaper00031936 | ||||
Curator_confirmed | WBPerson2021 | ||||||||
Phenotype_assay | Treatment | 10% CO2 | Paper_evidence | WBPaper00031936 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
WBPhenotype:0001780 | Paper_evidence | WBPaper00029060 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | Mutants show normal butanone enhancement | Paper_evidence | WBPaper00029060 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
EQ_annotations | Life_stage | WBls:0000057 | PATO:0000460 | Paper_evidence | WBPaper00029060 | ||||
Curator_confirmed | WBPerson2021 | ||||||||
Phenotype_assay | Treatment | Preexposure to 1:10 dilution of butanone and food. Animals were then subjected to odorant chemotaxis assays and/or selection assays | Paper_evidence | WBPaper00029060 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
WBPhenotype:0002469 | Paper_evidence | WBPaper00005404 | |||||||
Curator_confirmed | WBPerson10038 | ||||||||
Remark | quoted from paper: "Figure 4A shows the average response magnitudes for reversals in the three blocks of training on day 1 and the test block on day 2. When stimulated with trains of taps, the eat-4 worms showed normal short term habituation over each block of stimuli." | Paper_evidence | WBPaper00005404 | ||||||
Curator_confirmed | WBPerson10038 | ||||||||
Phenotype_assay | Control_strain | WBStrain00000001 | Paper_evidence | WBPaper00005404 | |||||
Curator_confirmed | WBPerson10038 | ||||||||
WBPhenotype:0002568 | Paper_evidence | WBPaper00005404 | |||||||
Curator_confirmed | WBPerson10038 | ||||||||
Remark | quoted from paper: "Using the new group-training procedure with the stronger train of taps resulted in significant long-term memory for habituation training in the group of eat-4 mutants that received distributed training (t(34)=2.54, P<0.05) when compared with the single train control group (Fig. 5)." | Paper_evidence | WBPaper00005404 | ||||||
Curator_confirmed | WBPerson10038 | ||||||||
Phenotype_assay | Control_strain | WBStrain00000001 | Paper_evidence | WBPaper00005404 | |||||
Curator_confirmed | WBPerson10038 | ||||||||
Reference (19) | |||||||||
Method | Deletion_allele |