General
People
Want to know more about worm research?
Start here to access information about the species and data available at WormBase [Read more]
Latest updates
Need help?
Get Started
General Search
By Sequence
By Object
By Literature
Data Mining and Batch Queries
For Parasites
For Developers
Top 3 most used tools
Need help?
Get Started
Tools
Commonly requested data
Need help?
External links
We've created different user guides for distinct interests and experience levels [Read more]
Still have questions?
Please use our most recent publication to cite WormBase. Your citation is critical for ensuring the continued development of WormBase! [Read more]
expand all nodes | collapse all nodes | view schema
| WBAntibody00000510 | Summary | Mouse polyclonal peptide antibody against PAT-4. | ||
|---|---|---|---|---|
| Public_name | [cgc5261]:pat-4 | |||
| Gene | WBGene00003931 | |||
| Isolation | Original_publication | WBPaper00005261 | ||
| Location | WB | |||
| Clonality | Polyclonal | |||
| Antigen | Peptide | CKNTILEIAQEHGQSPNDRVPFKDTTWKGTK | ||
| Animal | Mouse | |||
| Interactor | WBInteraction000557578 | |||
| WBInteraction000557579 | ||||
| WBInteraction000557580 | ||||
| Reference | WBPaper00005261 |
