WormBase Tree Display for Variation: WBVar02144026
expand all nodes | collapse all nodes | view schema
WBVar02144026 | Name | Public_name | tm7440 | |||||
---|---|---|---|---|---|---|---|---|
Other_name | Y50E8A.16.1:c.54_164del | |||||||
CE24404:p.Ile18_Leu55delinsMet | ||||||||
HGVSg | CHROMOSOME_V:g.14773444_14773554del | |||||||
Sequence_details | SMap | S_parent | Sequence | Y50E8A | ||||
Flanking_sequences | attattgcttctgcatgtaatatttgacat | ggattttgtcggcctctgcctctttcggca | ||||||
Mapping_target | Y50E8A | |||||||
Source_location | 7 | CHROMOSOME_V | 14773443 | 14773555 | Inferred_automatically | National_Bioresource_Project | ||
Type_of_mutation | Deletion | |||||||
PCR_product | tm7440_external | |||||||
tm7440_internal | ||||||||
SeqStatus | Sequenced | |||||||
Variation_type | Allele | |||||||
Origin | Species | Caenorhabditis elegans | ||||||
Laboratory | FX | |||||||
Author | Mitani S | |||||||
DB_info | Database | National_Bioresource_Project | seq | 7440 | ||||
NBP_allele | ||||||||
Status | Live | |||||||
Affects | Gene | WBGene00001817 | ||||||
Transcript | Y50E8A.16.1 | VEP_consequence | inframe_deletion | |||||
VEP_impact | MODERATE | |||||||
HGVSc | Y50E8A.16.1:c.54_164del | |||||||
HGVSp | CE24404:p.Ile18_Leu55delinsMet | |||||||
cDNA_position | 187-297 | |||||||
CDS_position | 54-164 | |||||||
Protein_position | 18-55 | |||||||
Exon_number | 2/6 | |||||||
Codon_change | atATCCTTCACAATCATCTCCCTTGGATTCTACACTCCCGGGTGGGTATTCAATCTGGATGATGTCTTCAAGACATTTCATATTAATGACTACAACTACATGATTTCTCCATTg/atg | |||||||
Amino_acid_change | ISFTIISLGFYTPGWVFNLDDVFKTFHINDYNYMISPL/M | |||||||
Isolation | Mutagen | TMP/UV | ||||||
Genetics | Map | V | ||||||
Description | Phenotype_not_observed | WBPhenotype:0000062 | Person_evidence | WBPerson7743 | ||||
Curator_confirmed | WBPerson712 | |||||||
Remark | Classified as homozygous viable by the National BioResource Project of Japan. | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | |||||||
Remark | 48459/48460-48570/48571 (111 bp deletion) | |||||||
This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. | Paper_evidence | WBPaper00041807 | ||||||
Method | NBP_knockout_allele |