WormBase Tree Display for Variation: WBVar02144026

WBVar02144026 Name: Public_name: tm7440
    Other_name: Y50E8A.16.1:c.54_164del
      CE24404:p.Ile18_Leu55delinsMet
    HGVSg: CHROMOSOME_V:g.14773444_14773554del
  Sequence_details: SMap: S_parent: Sequence: Y50E8A
    Flanking_sequences: attattgcttctgcatgtaatatttgacat ggattttgtcggcctctgcctctttcggca
    Mapping_target: Y50E8A
    Source_location: 7 CHROMOSOME_V 14773443 14773555 Inferred_automatically: National_Bioresource_Project
    Type_of_mutation: Deletion
    PCR_product: tm7440_external
      tm7440_internal
    SeqStatus: Sequenced
  Variation_type: Allele
  Origin: Species: Caenorhabditis elegans
    Laboratory: FX
    Author: Mitani S
    DB_info: Database: National_Bioresource_Project seq 7440
    NBP_allele
    Status: Live
  Affects: Gene: WBGene00001817
    Transcript: Y50E8A.16.1 VEP_consequence: inframe_deletion
        VEP_impact: MODERATE
        HGVSc: Y50E8A.16.1:c.54_164del
        HGVSp: CE24404:p.Ile18_Leu55delinsMet
        cDNA_position: 187-297
        CDS_position: 54-164
        Protein_position: 18-55
        Exon_number: 2/6
        Codon_change: atATCCTTCACAATCATCTCCCTTGGATTCTACACTCCCGGGTGGGTATTCAATCTGGATGATGTCTTCAAGACATTTCATATTAATGACTACAACTACATGATTTCTCCATTg/atg
        Amino_acid_change: ISFTIISLGFYTPGWVFNLDDVFKTFHINDYNYMISPL/M
  Isolation: Mutagen: TMP/UV
  Genetics: Map: V
  Description: Phenotype_not_observed: WBPhenotype:0000062 Person_evidence: WBPerson7743
        Curator_confirmed: WBPerson712
        Remark: Classified as homozygous viable by the National BioResource Project of Japan. Person_evidence: WBPerson7743
            Curator_confirmed: WBPerson712
  Remark: 48459/48460-48570/48571 (111 bp deletion)
    This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. Paper_evidence: WBPaper00041807
  Method: NBP_knockout_allele