WormBase Tree Display for Variation: WBVar00250733
expand all nodes | collapse all nodes | view schema
WBVar00250733 | Name | Public_name | tm1768 | ||||||
---|---|---|---|---|---|---|---|---|---|
Other_name | CE06191:p.Ile36_Ter128delinsLysLeuLeuLeuAlaLeu | ||||||||
M05B5.5a.1:c.107_384delinsAGCTGTTGTTGGCTTTA | |||||||||
HGVSg | CHROMOSOME_I:g.7193174_7193801delinsTAAAGCCAACAACAGCT | ||||||||
Sequence_details | SMap | S_parent | Sequence | C01H6 | |||||
Flanking_sequences | aacaatcgctgatgtttctgcagaattcgt | ttataaggataatcatatgcatttggaagc | |||||||
Mapping_target | C01H6 | ||||||||
Source_location | 7 | CHROMOSOME_I | 7193173 | 7193804 | Inferred_automatically | National_Bioresource_Project | |||
Type_of_mutation | Insertion | TAAAGCCAACAACAGCTTA | |||||||
Deletion | |||||||||
PCR_product | tm1768_external | ||||||||
tm1768_internal | |||||||||
SeqStatus | Sequenced | ||||||||
Variation_type | Allele | ||||||||
Origin | Species | Caenorhabditis elegans | |||||||
Strain | WBStrain00022642 | ||||||||
Laboratory | FX | ||||||||
Author | Mitani S | ||||||||
DB_info | Database | National_Bioresource_Project | seq | 1768 | |||||
NBP_allele | |||||||||
Status | Live | ||||||||
Affects | Gene | WBGene00001949 | |||||||
Transcript | M05B5.5a.1 | VEP_consequence | splice_acceptor_variant,splice_donor_variant,stop_lost,protein_altering_variant,intron_variant | ||||||
VEP_impact | HIGH | ||||||||
HGVSc | M05B5.5a.1:c.107_384delinsAGCTGTTGTTGGCTTTA | ||||||||
HGVSp | CE06191:p.Ile36_Ter128delinsLysLeuLeuLeuAlaLeu | ||||||||
cDNA_position | 118-397 | ||||||||
CDS_position | 105-384 | ||||||||
Protein_position | 35-128 | ||||||||
Intron_number | 2/6 | ||||||||
Exon_number | 2-3/7 | ||||||||
Codon_change | aaTATTGATCCGACAACGATTCAGATGCCTGATTATTGGAGTGGTTAGTCTTTTTTTCATTTGAAATCTATTATAATTTCAATTATATCATTTGGTAAACCAAACCAAACATGTTTTCGTGAATTTGTTAAAAGTCGCTTGTAATCAGTTAGAAATATTGGATAAATTGCAGAAAAAGGATATAAGTTTGGTATTACTTATCTCGAATTGTTGAATTGTTGATTTTATAAGCTCGCAAATTTTTAAAATTTACTTTAAGTTGAAACAAAATGTATAACTCTTTTAATGTTCTAAAATTTTGTAAAAATCTGGTTTGCTCTAGTAAGTAGTTTATTAACCAAAATGTTTATATCTCATTTCTCAAGTGCAAGTCATCTAAATAAACATTTTCAGGATACCATCTCAACCCGTATCCTCCGATGCAAACAACGGATATTGATTATTCATCAGCCTTCCTTCCAACACATCCACCAACTGAAACCCCTGCTTCCGTAGCTGCTCCAACTTCTGCAACATCTGATATTAAGCCAATTCATGCAACATCATCCACTTCAACGACGGCTCCATCTACTGCTCCAGCTCCAACTTCAACTACTGATGTGCTTGAGTTAAAGCCAACAACAGCTCCAGCC/aaTAAGCTGTTGTTGGCTTTA | ||||||||
Amino_acid_change | NIDPTTIQMPDYWSG*SFFHLKSIIISIISFGKPNQTCFREFVKSRL*SVRNIG*IAEKGYKFGITYLELLNC*FYKLANF*NLL*VETKCITLLMF*NFVKIWFALVSSLLTKMFISHFSSASHLNKHFQDTISTRILRCKQRILIIHQPSFQHIHQLKPLLP*LLQLLQHLILSQFMQHHPLQRRLHLLLQLQLQLLMCLS*SQQQLQX/NKLLLAL | ||||||||
Interactor | WBInteraction000052005 | ||||||||
WBInteraction000052006 | |||||||||
WBInteraction000052007 | |||||||||
WBInteraction000501329 | |||||||||
WBInteraction000503977 | |||||||||
WBInteraction000517476 | |||||||||
WBInteraction000517477 | |||||||||
Isolation | Mutagen | TMP/UV | |||||||
Genetics | Map | I | |||||||
Description | Phenotype | WBPhenotype:0000184 | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson48 | ||||||||
Remark | Comment from Dr. B. Conradt to the National Bioresource Project of Japan: 3% NSM sister cell survival at 20C. | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
Laboratory_evidence | MD | ||||||||
Penetrance | Low | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
Range | 3 | 3 | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson48 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0003666 | PATO:0000460 | Person_evidence | WBPerson7743 | ||||
Curator_confirmed | WBPerson48 | ||||||||
WBPhenotype:0000188 | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | Gonadal arms were short | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Recessive | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Variation_effect | Hypomorph_reduction_of_function | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Temperature_sensitive | Heat_sensitive | 25C | Paper_evidence | WBPaper00033102 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
WBPhenotype:0000396 | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | Gonad arms were not reflexed in most gonads | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Recessive | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Variation_effect | Hypomorph_reduction_of_function | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Temperature_sensitive | Heat_sensitive | 25C | Paper_evidence | WBPaper00033102 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
WBPhenotype:0000684 | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | A dramatic reduction in germ cell number was observed when hlh-2(tm1768) mutants were shifted to 25 C | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Variation_effect | Hypomorph_reduction_of_function | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Temperature_sensitive | Heat_sensitive | 25C | Paper_evidence | WBPaper00033102 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
Phenotype_assay | Treatment | DAPI staining | Paper_evidence | WBPaper00033102 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
WBPhenotype:0000688 | Paper_evidence | WBPaper00039950 | |||||||
Person_evidence | WBPerson7743 | ||||||||
Curator_confirmed | WBPerson48 | ||||||||
WBPerson712 | |||||||||
Remark | Comment to the National Bioresource Project of Japan from Dr. B. Conradt: sterile at 25C; Dr. J. Kimble: Dev. Biol. 331, 14 (2009). | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
Laboratory_evidence | MD | ||||||||
The allele is fully sterile at 25 deg C and partially sterile at 20 deg C. | Paper_evidence | WBPaper00039950 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Temperature_sensitive | Heat_sensitive | 25 | Paper_evidence | WBPaper00039950 | |||||
Person_evidence | WBPerson7743 | ||||||||
Curator_confirmed | WBPerson48 | ||||||||
WBPerson712 | |||||||||
WBPhenotype:0000690 | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | This allele exhibited recessive defects in hermaphrodite gonad arm migration (data not shown) | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Recessive | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Variation_effect | Hypomorph_reduction_of_function | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Temperature_sensitive | Heat_sensitive | 25C | Paper_evidence | WBPaper00033102 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
WBPhenotype:0000893 | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | The hlh-2(tm1768) males had a significantly smaller germline mitotic region than controls | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Variation_effect | Hypomorph_reduction_of_function | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Temperature_sensitive | Heat_sensitive | 25C | Paper_evidence | WBPaper00033102 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
WBPhenotype:0001652 | Paper_evidence | WBPaper00039950 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Animals exhibit a significant, 5%, defect in AC invasion at the P6.p four-cell stage. hlh-2(tm1768) animals with zero or299 two ACs were not observed. Defect is not stronger at higher temperatures. | Paper_evidence | WBPaper00039950 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Penetrance | Low | Paper_evidence | WBPaper00039950 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0001656 | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | Weakly dominant defects in hermaphrodite DTC specification. hlh-2 (tm1768 +RNAi) mutants at 25C show more severe DTC loss in hermaphrodites and linker cell loss in males as indicated by lag-2 and ceh-22 reporters | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Semi_dominant | Paper_evidence | WBPaper00033102 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Variation_effect | Hypomorph_reduction_of_function | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
EQ_annotations | Life_stage | WBls:0000057 | PATO:0000460 | Paper_evidence | WBPaper00033102 | ||||
Curator_confirmed | WBPerson2021 | ||||||||
WBls:0000056 | PATO:0000460 | Paper_evidence | WBPaper00033102 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Temperature_sensitive | Heat_sensitive | 25C | Paper_evidence | WBPaper00033102 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
Phenotype_assay | Genotype | qIs57[lag-2::GFP] , qIs56[lag-2::GFP], qIs90[ceh- 22b::VENUS] | Paper_evidence | WBPaper00033102 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
Phenotype_not_observed | WBPhenotype:0000062 | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
Remark | Classified as homozygous viable by the National Bioresource Project of Japan. | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
Laboratory_evidence | FX | ||||||||
Reference | WBPaper00039950 | ||||||||
WBPaper00033102 | |||||||||
Remark | [C01H6] 1369/1370-TAAAGCCAACAACAGCTTA-[C01H6] 1999/2000 (630 bp deletion + 19 bp insertion) | ||||||||
This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. | Paper_evidence | WBPaper00041807 | |||||||
Method | NBP_knockout_allele |