WormBase Tree Display for Variation: WBVar00143024
expand all nodes | collapse all nodes | view schema
WBVar00143024 | Evidence | Paper_evidence | WBPaper00000779 | ||||||
---|---|---|---|---|---|---|---|---|---|
Name (3) | |||||||||
Sequence_details | SMap | S_parent | Sequence | F32A7 | |||||
Flanking_sequences | acgctctgtccacgaaatgcaaaagatcat | gagccgacacccgtgaacaattcttcaacg | |||||||
Mapping_target | F32A7 | ||||||||
Type_of_mutation | Deletion | ||||||||
SeqStatus | Sequenced | ||||||||
Variation_type | Allele | ||||||||
Origin | Species | Caenorhabditis elegans | |||||||
Strain | WBStrain00004124 | ||||||||
WBStrain00004379 | |||||||||
WBStrain00004380 | |||||||||
WBStrain00006209 | |||||||||
WBStrain00006253 | |||||||||
WBStrain00006286 | |||||||||
WBStrain00028624 | |||||||||
WBStrain00030552 | |||||||||
WBStrain00030693 | |||||||||
WBStrain00033514 | |||||||||
WBStrain00034126 | |||||||||
WBStrain00036087 | |||||||||
WBStrain00040279 | |||||||||
Laboratory | CB | ||||||||
Status | Live | ||||||||
Affects | Gene | WBGene00006789 | |||||||
Transcript | F11C3.3.1 | VEP_consequence | frameshift_variant | ||||||
VEP_impact | HIGH | ||||||||
HGVSc | F11C3.3.1:c.4617_5017del | ||||||||
HGVSp | CE09349:p.Ile1539MetfsTer6 | ||||||||
cDNA_position | 4649-5049 | ||||||||
CDS_position | 4617-5017 | ||||||||
Protein_position | 1539-1673 | ||||||||
Exon_number | 7/11 | ||||||||
Codon_change | atCCGCCGTCTTGAGATTGAGAAGGAAGAACTCCAACACGCTTTGGACGAGGCTGAGGCTGCCCTTGAAGCTGAAGAGAGCAAGGTTCTCCGCGCCCAGGTTGAAGTTTCCCAGATCCGTTCCGAAATCGAGAAACGCATCCAGGAGAAGGAGGAAGAGTTCGAGAACACGAGAAAGAACCACGCCCGCGCTCTTGAATCAATGCAAGCTTCCCTCGAGACCGAAGCTAAAGGAAAGGCCGAACTTCTCCGCATCAAGAAGAAGCTCGAGGGAGATATCAACGAGCTCGAGATCGCTTTGGACCACGCCAACAAGGCTAACGCCGATGCCCAGAAGAACTTGAAGAGATACCAAGAGCAAGTCCGCGAGTTGCAATTGCAAGTCGAGGAGGAGCAACGCAATGga/atga | ||||||||
Amino_acid_change | IRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNG/MX | ||||||||
Interactor | WBInteraction000518611 | ||||||||
WBInteraction000538533 | |||||||||
WBInteraction000555983 | |||||||||
Isolation | Mutagen | EMS | Paper_evidence | WBPaper00000779 | |||||
Genetics | Interpolated_map_position | I | 27.9601 | ||||||
Mapping_data | In_2_point (14) | ||||||||
In_multi_point (20) | |||||||||
In_pos_neg_data | 333 | ||||||||
Marked_rearrangement | hT2[unc-54(e190)] | ||||||||
Description | Phenotype (13) | ||||||||
Phenotype_not_observed | WBPhenotype:0000195 | Paper_evidence | WBPaper00005809 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "Mutations in unc-22 or unc-54 that disrupt the function and structure of body wall muscles (Moerman et al., 1986) had no significant effect on the frequency of DTC migration defects (Table 1; P > 0.3)." | Paper_evidence | WBPaper00005809 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0006865 | PATO:0000460 | Paper_evidence | WBPaper00005809 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
GO_term | GO:0016477 | PATO:0000460 | Paper_evidence | WBPaper00005809 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Genotype | unc-5(e152) | Paper_evidence | WBPaper00005809 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0001236 | Paper_evidence | WBPaper00056554 | |||||||
Curator_confirmed | WBPerson5649 | ||||||||
Remark | expression of mgIs72[rpt-3::gfp] transgene was not increased | Paper_evidence | WBPaper00056554 | ||||||
Curator_confirmed | WBPerson5649 | ||||||||
Phenotype_assay | Control_strain | WBStrain00007961 | Paper_evidence | WBPaper00056554 | |||||
Curator_confirmed | WBPerson5649 | ||||||||
Genotype | mgIs72 [rpt-3::gfp] | Paper_evidence | WBPaper00056554 | ||||||
Curator_confirmed | WBPerson5649 | ||||||||
WBPhenotype:0001426 | Paper_evidence | WBPaper00004883 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Phenotype_assay | Genotype | arIs37 | Paper_evidence | WBPaper00004883 | |||||
Curator_confirmed | WBPerson712 | ||||||||
Reference (33) | |||||||||
Method | Deletion_allele |