WormBase Tree Display for Variation: WBVar00088286
expand all nodes | collapse all nodes | view schema
WBVar00088286 | Evidence | Paper_evidence | WBPaper00003851 | ||||||
---|---|---|---|---|---|---|---|---|---|
Name | Public_name | ks52 | |||||||
Other_name | C01G6.8c.1:c.1105_2112del | ||||||||
C01G6.8b.1:c.1504_2511del | |||||||||
CE32563:p.Thr528_Ala863delextTer? | |||||||||
C01G6.8c.2:c.1105_2112del | |||||||||
CE39126:p.Thr369_Ala704delextTer? | |||||||||
CE24774:p.Thr502_Ala837delextTer? | |||||||||
C01G6.8a.1:c.1582_2589del | |||||||||
HGVSg | CHROMOSOME_II:g.9296655_9297713del | ||||||||
Sequence_details | SMap | S_parent | Sequence | C01G6 | |||||
Flanking_sequences | aattctgcatattatcggaaattaaatgga | agtccagctcattcgattcttcagcagcat | |||||||
Mapping_target | C01G6 | ||||||||
Type_of_mutation | Deletion | ||||||||
SeqStatus | Sequenced | ||||||||
Variation_type | Allele | ||||||||
Origin | Species | Caenorhabditis elegans | |||||||
Strain | WBStrain00007507 | ||||||||
Laboratory | FK | ||||||||
Status | Live | ||||||||
Affects | Gene | WBGene00000289 | |||||||
Transcript | C01G6.8c.1 (11) | ||||||||
C01G6.8b.1 | VEP_consequence | splice_acceptor_variant,splice_donor_variant,stop_lost,inframe_deletion,intron_variant | |||||||
VEP_impact | HIGH | ||||||||
HGVSc | C01G6.8b.1:c.1504_2511del | ||||||||
HGVSp | CE24774:p.Thr502_Ala837delextTer? | ||||||||
cDNA_position | 1536-2543 | ||||||||
CDS_position | 1504-2511 | ||||||||
Protein_position | 502-837 | ||||||||
Intron_number | 7/9 | ||||||||
Exon_number | 7-8/10 | ||||||||
Codon_change | ACAAGTACACCTATAATGGGACGGGTACCTCCTCACGTTGAAATGACATCACTTCTCCCATCTGCACAACATCTCGGACCTCCACCATATCCAATGGATCAACATCTCCAACAAGCTCGTCGTTTTCCATCTCAAGAGCCAATTGATGATAACTCTTACAAGGTCTTTGAAATCACTCCATCACAGTTGAGTGTTCGCGAGAAAATTGGAGAAGGACAGTTTGGAGTTGTGCATTCTGGAATCTATACATCAGGATTATTTGCTCCGGAACCGATGGCTGTAGCAGTTAAGAAATGCAGACATGACGCAACGAATGCCGAAAGAGCACAACTTGAGCAGGAGATTCGTGCAGTTGCGACATTTGATCATCCGAATGTCATTAAGCTTATCGGTGTCTGTTATATGGATAACTCTCTTCTCGCAGTTTTTGAGTACATGGTTCATGGTGATCTTCACGAGTTGCTGAAGGTTCGAGTGCCACCAGCGGATCATGATATGGGAGGAATTACGGAGGCAAACGCTGAGTTCTTGTATATTGCGACTCAAATTGCACTTGGAATGGAATATCTCGCGTCAATGTCATTTGTGCATAGGGATTTGGCAACGAGAAATTGTTTGGTTGGAGATACAAGGACTATTAAGATTGCTGATTTTGGATTGATGAGAACAAGCTATGGAAGTGATTATTATAAGGTTTGTAGTTTTCTTCCCATAAAACATTGATTAAAATATTTTATTTTTTAGATGCTCCATCGCTCTTGGATGCCAGTCCGTTGGATGTCAAAAGAAGCAATTGAACAAGGAAGATTCAGTGAAGCATCTGATGTATGGTCATTTGGAGTCACACTTTGGGAAATTTGGTCTTTCGGTCGTCAACCATACGAAGGAGCATCGAATCAACAAGTTATTGAGCTTGTTGCAAACCGACATTTACTAGAATGCCCTCACAATTGTCCAACCAACATCTACAGTTTGATGGTTGAATGTTGGCATGAAAACATTGAGCGAAGACCAACATTCTCGGAAATTCGTAGTCGATTGCAGTCATGGTCATTGGCA/- | ||||||||
Amino_acid_change | TSTPIMGRVPPHVEMTSLLPSAQHLGPPPYPMDQHLQQARRFPSQEPIDDNSYKVFEITPSQLSVREKIGEGQFGVVHSGIYTSGLFAPEPMAVAVKKCRHDATNAERAQLEQEIRAVATFDHPNVIKLIGVCYMDNSLLAVFEYMVHGDLHELLKVRVPPADHDMGGITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRTIKIADFGLMRTSYGSDYYKVCSFLPIKH*LKYFIF*MLHRSWMPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGRQPYEGASNQQVIELVANRHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQSWSLA/- | ||||||||
C01G6.8c.2 (11) | |||||||||
C01G6.8a.1 (11) | |||||||||
Interactor | WBInteraction000050666 | ||||||||
WBInteraction000501680 | |||||||||
Genetics | Interpolated_map_position | II | 1.10196 | ||||||
Description | Phenotype | WBPhenotype:0000232 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "In cam-1 mutants, CAN neurons usually fail to migrate to their proper positions; they are misplaced anteriorly either near their starting points or along their migratory routes... In cam-1(ks52) mutants, CAN, ALM, BDU, and HSN migration are much less severely defective than in cam-1(gm122) or cam-1(sa692) mutants (Fig. 3, Table 1), confirming that the kinase domain is not required for proper embryonic cell migration." | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Penetrance | Incomplete | 35 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0006827 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
Life_stage | WBls:0000024 | PATO:0000460 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Treatment | "CAN was scored as defective if its nucleus was anterior to the V3 nucleus." | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000469 | Paper_evidence | WBPaper00006269 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "The final positions of QR descendants in cam-1(ks52) mutants were shifted slightly posterior to normal, suggesting that the kinase domain might play a minor role in QR migration." (Table 1, Figure 5) | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Penetrance | Incomplete | 18 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0004991 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0003832 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004054 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Life_stage | WBls:0000024 | PATO:0000460 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Treatment | "Because they occupy positions near each other, the data for SDQR and AVM were combined and are presented in QR column. SDQR and AVM were scored as defective if their nuclei were posterior to the V2.a nucleus." | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000470 | Paper_evidence | WBPaper00006269 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "In cam-1(ks52) mutants, CAN, ALM, BDU, and HSN migration are much less severely defective than in cam-1(gm122) or cam-1(sa692) mutants (Fig. 3, Table 1), confirming that the kinase domain is not required for proper embryonic cell migration." | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Penetrance | Incomplete | 12 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0006830 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
Life_stage | WBls:0000024 | PATO:0000460 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Treatment | "Because HSN sometimes was misplaced anteriorly and other times was misplaced posteriorly, we present the data for both phenotypes. HSN was scored as misplaced anteriorly if its nucleus was anterior to the P5/6 nucleus and misplaced posteriorly if its nucleus was posterior to the V4 nucleus." | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000471 | Paper_evidence | WBPaper00006269 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "In cam-1(ks52) mutants, CAN, ALM, BDU, and HSN migration are much less severely defective than in cam-1(gm122) or cam-1(sa692) mutants (Fig. 3, Table 1), confirming that the kinase domain is not required for proper embryonic cell migration." | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Penetrance | Low | 7 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0005406 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
Life_stage | WBls:0000024 | PATO:0000460 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Treatment | "ALM was scored as defective if its nucleus was anterior to the V2 nucleus." | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000594 | Paper_evidence | WBPaper00006269 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "In cam-1(ks52) mutants, CAN, ALM, BDU, and HSN migration are much less severely defective than in cam-1(gm122) or cam-1(sa692) mutants (Fig. 3, Table 1), confirming that the kinase domain is not required for proper embryonic cell migration." | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Penetrance | Low | 7 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0006826 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
Life_stage | WBls:0000024 | PATO:0000460 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Treatment | "Because BDU sometimes was misplaced anteriorly and other times was misplaced posteriorly, we present the data for both phenotypes. BDU was scored as misplaced anteriorly if its nucleus was anterior to its normal position immediately anterior to V1 and misplaced posteriorly if its nucleus was posterior to the V1 nucleus." | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0001224 | Paper_evidence | WBPaper00060654 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Loss of cam-1, but not the other receptors, caused defective SMDD axonal development (Figure 1D). | Paper_evidence | WBPaper00060654 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0004972 | PATO:0000460 | Paper_evidence | WBPaper00060654 | ||||
Curator_confirmed | WBPerson712 | ||||||||
WBbt:0004971 | PATO:0000460 | Paper_evidence | WBPaper00060654 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0002212 | Paper_evidence | WBPaper00061480 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | "Consistent with a previous report (Koga et al. 1999), we saw that cam-1/kin-8 mutants had a specific dye-filling defect in ASI neurons (Fig. 1C, E)." | Paper_evidence | WBPaper00061480 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0005665 | PATO:0000460 | Paper_evidence | WBPaper00061480 | ||||
Curator_confirmed | WBPerson712 | ||||||||
WBbt:0005661 | PATO:0000460 | Paper_evidence | WBPaper00061480 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBbt:0005666 | PATO:0000460 | Paper_evidence | WBPaper00061480 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBbt:0005671 | PATO:0000460 | Paper_evidence | WBPaper00061480 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBbt:0005668 | PATO:0000460 | Paper_evidence | WBPaper00061480 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBbt:0005667 | PATO:0000460 | Paper_evidence | WBPaper00061480 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0002535 | Paper_evidence | WBPaper00061480 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Consistent with a previous report (Koga et al. 1999), we saw that cam-1/kin-8 mutants had a specific dye-filling defect in ASI neurons (Fig. 1C, E). | Paper_evidence | WBPaper00061480 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0005666 | PATO:0000460 | Paper_evidence | WBPaper00061480 | ||||
Curator_confirmed | WBPerson712 | ||||||||
Phenotype_not_observed | WBPhenotype:0000155 | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | Table 2 | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term (12) | ||||||||
Life_stage | WBls:0000024 | PATO:0000460 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000218 | Paper_evidence | WBPaper00031110 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | No significant number of overinduced animals (worms with greater than three VPCs induced) were detected. | Paper_evidence | WBPaper00031110 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000219 | Paper_evidence | WBPaper00031110 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | No underinduced animals (worms with fewer than 22 vulval cells or fewer than three VPCs induced) were detected. | Paper_evidence | WBPaper00031110 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000469 | Paper_evidence | WBPaper00006269 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "To further investigate the role in Q cell migration of CAM-1 domains, we assessed the position of Q cell descendants in cam-1(sa692) and cam-1(ks52) (Fig. 5, Table 1). The final positions of QL descendants were similar in all three cam-1 mutants to wild type, suggesting that CAM-1 is not required for proper QL migration." | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0004993 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004086 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004056 | PATO:0000460 | Paper_evidence | WBPaper00006269 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Life_stage | WBls:0000024 | PATO:0000460 | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Treatment | "The percentage of QL cell descendants that were not located posterior to V4.p is presented. These represent QL descendants that have migrated anteriorly, rather than posteriorly. Because they occupy positions near each other, the data for SDQL and PVM were combined." | Paper_evidence | WBPaper00006269 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000883 | Paper_evidence | WBPaper00035405 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | Nerve ring development is normal | Paper_evidence | WBPaper00035405 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
WBPhenotype:0001660 | Paper_evidence | WBPaper00006052 | |||||||
Curator_confirmed | WBPerson2021 | ||||||||
Remark | No disruption of ASE asymmetry (as seen with lim-6 reporters) | Paper_evidence | WBPaper00006052 | ||||||
Curator_confirmed | WBPerson2021 | ||||||||
Phenotype_assay | Genotype | otIs114, otIs6 | Paper_evidence | WBPaper00006052 | |||||
Curator_confirmed | WBPerson2021 | ||||||||
Reference | WBPaper00031110 | ||||||||
WBPaper00006052 | |||||||||
WBPaper00006269 | |||||||||
WBPaper00035405 | |||||||||
WBPaper00060654 | |||||||||
WBPaper00061480 | |||||||||
Method | Deletion_allele |