WormBase Tree Display for Variation: WBVar02152642
expand all nodes | collapse all nodes | view schema
WBVar02152642 | Name | Public_name | tm12386 | |||||
---|---|---|---|---|---|---|---|---|
Other_name | CE49736:p.Leu1153GlufsTer28 | |||||||
CE40156:p.Leu1190GlufsTer28 | ||||||||
F12B6.1b.1:c.3456_3571del | ||||||||
F12B6.1a.1:c.3567_3682del | ||||||||
HGVSg | CHROMOSOME_I:g.2262571_2262686del | |||||||
Sequence_details | SMap | S_parent | Sequence | F12B6 | ||||
Flanking_sequences | catgaaggatatcgttggcagtggaattct | aggacaaagagttcggccagggcgagcagg | ||||||
Mapping_target | F12B6 | |||||||
Source_location | 7 | CHROMOSOME_I | 2262570 | 2262687 | Inferred_automatically | National_Bioresource_Project | ||
Type_of_mutation | Deletion | |||||||
PCR_product | tm12386_external | |||||||
tm12386_internal | ||||||||
SeqStatus | Sequenced | |||||||
Variation_type | Allele | |||||||
Origin | Species | Caenorhabditis elegans | ||||||
Laboratory | FX | |||||||
Author | Mitani S | |||||||
DB_info | Database | National_Bioresource_Project | seq | 12386 | ||||
NBP_allele | ||||||||
Status | Live | |||||||
Affects | Gene | WBGene00000020 | ||||||
Transcript | F12B6.1a.1 | VEP_consequence | frameshift_variant | |||||
VEP_impact | HIGH | |||||||
HGVSc | F12B6.1a.1:c.3567_3682del | |||||||
HGVSp | CE40156:p.Leu1190GlufsTer28 | |||||||
cDNA_position | 3567-3682 | |||||||
CDS_position | 3567-3682 | |||||||
Protein_position | 1189-1228 | |||||||
Exon_number | 21/34 | |||||||
Codon_change | ctACTCCAAGTGTCAACTGCCCGTCCCGATCTGATGGTTTCGATGCCCCCGCTTCCACTCGAGACCAGCATAATGGGAAATCACAGTGATTTCTATGTGAACTCTTGGGATACCGCGGag/ctag | |||||||
Amino_acid_change | LLQVSTARPDLMVSMPPLPLETSIMGNHSDFYVNSWDTAE/LX | |||||||
F12B6.1b.1 | VEP_consequence | frameshift_variant | ||||||
VEP_impact | HIGH | |||||||
HGVSc | F12B6.1b.1:c.3456_3571del | |||||||
HGVSp | CE49736:p.Leu1153GlufsTer28 | |||||||
cDNA_position | 3456-3571 | |||||||
CDS_position | 3456-3571 | |||||||
Protein_position | 1152-1191 | |||||||
Exon_number | 21/33 | |||||||
Codon_change | ctACTCCAAGTGTCAACTGCCCGTCCCGATCTGATGGTTTCGATGCCCCCGCTTCCACTCGAGACCAGCATAATGGGAAATCACAGTGATTTCTATGTGAACTCTTGGGATACCGCGGag/ctag | |||||||
Amino_acid_change | LLQVSTARPDLMVSMPPLPLETSIMGNHSDFYVNSWDTAE/LX | |||||||
Isolation | Mutagen | TMP/UV | ||||||
Genetics | Map | I | ||||||
Remark | 23045/23046-23161/23162(116 bp deletion) | |||||||
This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. | Paper_evidence | WBPaper00041807 | ||||||
Method | NBP_knockout_allele |