WormBase Tree Display for Variation: WBVar00144045
expand all nodes | collapse all nodes | view schema
WBVar00144045 | Evidence | Paper_evidence | WBPaper00003969 | |||
---|---|---|---|---|---|---|
Name | Public_name | e1497 | ||||
Other_name | T01C8.7.1:c.1917_2045del | |||||
CE39109:p.Cys640_Lys682del | ||||||
HGVSg | CHROMOSOME_X:g.16803841_16803969del | |||||
Sequence_details | SMap | S_parent | Sequence | T01C8 | ||
Flanking_sequences | taaataaaaaactgcaatttcaattttaag | gtaagttaattcaagaaaaaacacacttta | ||||
Mapping_target | T01C8 | |||||
Type_of_mutation (2) | ||||||
SeqStatus | Sequenced | |||||
Variation_type | Allele | |||||
Origin | Species | Caenorhabditis elegans | ||||
Strain | WBStrain00004464 | |||||
Laboratory | CB | |||||
Status | Live | |||||
Affects | Gene | WBGene00003168 | ||||
Transcript | T01C8.7.1 | VEP_consequence | inframe_deletion,splice_region_variant | |||
VEP_impact | MODERATE | |||||
HGVSc | T01C8.7.1:c.1917_2045del | |||||
HGVSp | CE39109:p.Cys640_Lys682del | |||||
cDNA_position | 1918-2046 | |||||
CDS_position | 1917-2045 | |||||
Protein_position | 639-682 | |||||
Exon_number | 14/17 | |||||
Codon_change | agATGCCAACAACCATGCCGCCAGTCAATCTACTCCGTTACATACTCGCCGGCAAAGTGGCCGTCGTTATCTTTGCAAATTCAACTAGGATCGTGTAATGGTACAGCGGTAGAGTGTAATAAGCATTATAAa/aga | |||||
Amino_acid_change | RCQQPCRQSIYSVTYSPAKWPSLSLQIQLGSCNGTAVECNKHYK/R | |||||
Isolation | Mutagen | EMS | Paper_evidence | WBPaper00003969 | ||
Genetics | Interpolated_map_position | X | 24.0625 | |||
Mapping_data | In_2_point | 3645 | ||||
In_multi_point | 1544 | |||||
1545 | ||||||
In_pos_neg_data | 534 | |||||
535 | ||||||
537 | ||||||
538 | ||||||
539 | ||||||
1848 | ||||||
1919 | ||||||
2188 | ||||||
2332 | ||||||
3639 | ||||||
Description | Phenotype | WBPhenotype:0000456 | Paper_evidence | WBPaper00000502 | ||
Curator_confirmed | WBPerson712 | |||||
Recessive | Paper_evidence | WBPaper00000502 | ||||
Curator_confirmed | WBPerson712 | |||||
Reference (2) | ||||||
Remark | e1497 comprises a deletion and insertion within exon 13. The left and right flanks refer to the left and right of exon 13, respectively (exact nature of the lesion is not detailed in the paper). | Paper_evidence | WBPaper00003969 | |||
Method | Deletion_and_insertion_allele |