WormBase Tree Display for Variation: WBVar00248956
expand all nodes | collapse all nodes | view schema
WBVar00248956 | Evidence | Paper_evidence | WBPaper00002543 | ||||||
---|---|---|---|---|---|---|---|---|---|
Name (3) | |||||||||
Sequence_details | SMap | S_parent | Sequence | Y71F9B | |||||
Flanking_sequences | ttctccaaaatgatgcattctttgggcatc | cgacattgagctatgcaaagacctgcccta | |||||||
Mapping_target | Y71F9B | ||||||||
Type_of_mutation | Deletion | ||||||||
SeqStatus | Sequenced | ||||||||
Variation_type | Allele | ||||||||
Origin | Species | Caenorhabditis elegans | |||||||
Strain | WBStrain00030834 | ||||||||
Laboratory | PS | ||||||||
Status | Live | ||||||||
Affects | Gene | WBGene00003006 | |||||||
Transcript | Y71F9B.5a.1 (11) | ||||||||
Y71F9B.5b.1 (11) | |||||||||
Y71F9B.5a.2 | VEP_consequence | splice_acceptor_variant,splice_donor_variant,frameshift_variant,stop_lost,intron_variant | |||||||
VEP_impact | HIGH | ||||||||
HGVSc | Y71F9B.5a.2:c.22_92del | ||||||||
HGVSp | CE25569:p.Ile8ArgfsTer3 | ||||||||
cDNA_position | 349-419 | ||||||||
CDS_position | 22-92 | ||||||||
Protein_position | 8-31 | ||||||||
Intron_number | 3/11 | ||||||||
Exon_number | 3-4/12 | ||||||||
Codon_change | ATTCTACTATTTATTCCACTCGCCACAGGATCAATTTTCGATCAGGTAGACTTATTGGAAATCTGAAAAATCGATGCACCATGCCTTTAAAAAATTGCACTAAACTTGCGCGTCAAATCGGATGTATTTGATGCTTTGCCCATCCGTTGCACCATGTTTTCAAATTTTCGATTCACCATAAGCCTACGACTTCTGTCCTAAACTTGCGCGTCAAATATGGTGCACCGGGTGAGTCACTTGAAAAGTCGATGCACCTTGATCTCTGTTATTAAGTTTACAGTTTACAAAACTTGCGCGTCAAATATGGTGCACCCGGTGCGTCACCCATATCCTAAAAAGTTGATGCACCATGTTTTAATGCACTATGGTCATTTAGTGAATTTGTCCGTCAAATCTGGCGCATCTAGTCGTGCCACTTTCCTAGATTAAACACCAATTTTTCAACTTTTCAGGCGGTGAAAGGGAAATGCATTCCGATc/c | ||||||||
Amino_acid_change | ILLFIPLATGSIFDQVDLLEI*KIDAPCL*KIALNLRVKSDVFDALPIRCTMFSNFRFTISLRLLS*TCASNMVHRVSHLKSRCTLISVIKFTVYKTCASNMVHPVRHPYPKKLMHHVLMHYGHLVNLSVKSGASSRATFLD*TPIFQLFRR*KGNAFRX/X | ||||||||
Interactor | WBInteraction000002725 | ||||||||
WBInteraction000538502 | |||||||||
Genetics | Interpolated_map_position | I | -7.44086 | ||||||
Description | Phenotype | WBPhenotype:0000220 | Paper_evidence | WBPaper00024693 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | Vulva cell fate specification was abnormal as indicated by the expression patterns of the cdh-3::CFP and ceh-2::YFP transgenes (Figure 5) | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0004448 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004447 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004436 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004435 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004434 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004433 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004432 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000257 | Paper_evidence | WBPaper00002543 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Adult hermaphrodites exhibited phasmid defects as assayed by DiO dye-filling. | Paper_evidence | WBPaper00002543 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000306 | Paper_evidence | WBPaper00005357 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "The analysis of the expression pattern of lin-11::GFP (syIs53) in lin-17(n671) animals showed a good correlation between the ectopic invagination of P7.p lineage cells (55%, n = 53) and their altered pattern of lin-11::GFP expression (47%, n = 36) (Figs. 4D, 4F, and 5A). In a wild-type animal at the Pn.pxx stage, syIs53 expression is typically detected in P5.ppx and P7.pax cells (Figs. 4A and 4B). However, in lin-17(n671) animals, the pattern of expression is defective in P7.p but not in P5.p progeny. The most frequent defect is a mirror image of the wild-type pattern in P7.p progeny (compare Fig. 4D with Fig. 4B). The other defect is either a graded (Figs. 4E and 4F) or uniform distribution (not shown) of GFP in all P7.p progeny. Very few worms had correctly localized GFP (<5%, n = 21)... Another allele of lin-17, sy277, shows similar effects (data not shown)." | Paper_evidence | WBPaper00005357 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0006895 | PATO:0000460 | Paper_evidence | WBPaper00005357 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Genotype | syIs53 [lin-11::GFP] | Paper_evidence | WBPaper00005357 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000510 | Paper_evidence | WBPaper00005357 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "The ectopic vulval invagination defect of lin-17(sy277) animals was completely suppressed by lin-11(n389) (n = 300; Table 1)." | Paper_evidence | WBPaper00005357 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000695 | Paper_evidence | WBPaper00024693 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | Figure 5 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0001968 | Paper_evidence | WBPaper00005116 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | Table 4 | Paper_evidence | WBPaper00005116 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0002011 | Paper_evidence | WBPaper00024693 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | Figure 5 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0002193 | Paper_evidence | WBPaper00024693 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | In lin-17(sy277) mutants, P7.p daughters frequently displayed a greater amount of POP-1 protein in anterior daughter cell than posterior daughter cell, unlike wild type animals which usually display the opposite pattern (Table 1). The same deviant pattern occurred in P7.pa daughters and P7.pp daughters albeit with less penetrance. | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
"In wild type, vulA cells arise from the posterior daughter of P7.p (P7.pp). However, in lin-17(-), lin-18(-), and in double mutants, vulA cells most commonly arose from the anterior daughter of P7.p (P7.pa). This pattern of vulA specification suggests a reversal in the P7.p lineage at the first round of cell division." (Figure 5, Table 3) | Paper_evidence | WBPaper00024693 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term (12) | ||||||||
WBPhenotype:0002216 | Paper_evidence | WBPaper00024693 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | In lin-17(sy277) mutants, P7.p daughters frequently displayed a greater amount of POP-1 protein in anterior daughter cell than posterior daughter cell, unlike wild type animals which usually display the opposite pattern (Table 1). The same deviant pattern occurred in P7.pa daughters and P7.pp daughters albeit with less penetrance. | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0006983 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0007264 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0006984 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0007265 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0007266 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0004448 | PATO:0000460 | Paper_evidence | WBPaper00024693 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Reference | WBPaper00005357 | ||||||||
WBPaper00005116 | |||||||||
WBPaper00024693 | |||||||||
WBPaper00002543 | |||||||||
Remark | sy277 starts 51 bp upstream of SL1 splice site and ends in the second exon 26 bp downstream of the splice acceptor site. Feature: WBsf000261 was used as a reference to curate this information. | Paper_evidence | WBPaper00002543 | ||||||
Manually curated Gene associations preserved as a text remark so that VEP is the canonical predictor of consequence: WBGene00003006 Genomic_neighbourhood | Paper_evidence | WBPaper00002543 | |||||||
Method | Deletion_allele |