WormBase Tree Display for Variation: WBVar00143024
expand all nodes | collapse all nodes | view schema
WBVar00143024 | Evidence | Paper_evidence | WBPaper00000779 | ||||||
---|---|---|---|---|---|---|---|---|---|
Name | Public_name | e190 | |||||||
Other_name | F11C3.3.1:c.4617_5017del | ||||||||
CE09349:p.Ile1539MetfsTer6 | |||||||||
HGVSg | CHROMOSOME_I:g.14857211_14857611del | ||||||||
Sequence_details | SMap | S_parent | Sequence | F32A7 | |||||
Flanking_sequences | acgctctgtccacgaaatgcaaaagatcat | gagccgacacccgtgaacaattcttcaacg | |||||||
Mapping_target | F32A7 | ||||||||
Type_of_mutation | Deletion | ||||||||
SeqStatus | Sequenced | ||||||||
Variation_type | Allele | ||||||||
Origin | Species | Caenorhabditis elegans | |||||||
Strain (13) | |||||||||
Laboratory | CB | ||||||||
Status | Live | ||||||||
Affects | Gene | WBGene00006789 | |||||||
Transcript | F11C3.3.1 | VEP_consequence | frameshift_variant | ||||||
VEP_impact | HIGH | ||||||||
HGVSc | F11C3.3.1:c.4617_5017del | ||||||||
HGVSp | CE09349:p.Ile1539MetfsTer6 | ||||||||
cDNA_position | 4649-5049 | ||||||||
CDS_position | 4617-5017 | ||||||||
Protein_position | 1539-1673 | ||||||||
Exon_number | 7/11 | ||||||||
Codon_change | atCCGCCGTCTTGAGATTGAGAAGGAAGAACTCCAACACGCTTTGGACGAGGCTGAGGCTGCCCTTGAAGCTGAAGAGAGCAAGGTTCTCCGCGCCCAGGTTGAAGTTTCCCAGATCCGTTCCGAAATCGAGAAACGCATCCAGGAGAAGGAGGAAGAGTTCGAGAACACGAGAAAGAACCACGCCCGCGCTCTTGAATCAATGCAAGCTTCCCTCGAGACCGAAGCTAAAGGAAAGGCCGAACTTCTCCGCATCAAGAAGAAGCTCGAGGGAGATATCAACGAGCTCGAGATCGCTTTGGACCACGCCAACAAGGCTAACGCCGATGCCCAGAAGAACTTGAAGAGATACCAAGAGCAAGTCCGCGAGTTGCAATTGCAAGTCGAGGAGGAGCAACGCAATGga/atga | ||||||||
Amino_acid_change | IRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNG/MX | ||||||||
Interactor | WBInteraction000518611 | ||||||||
WBInteraction000538533 | |||||||||
WBInteraction000555983 | |||||||||
Isolation | Mutagen | EMS | Paper_evidence | WBPaper00000779 | |||||
Genetics | Interpolated_map_position | I | 27.9601 | ||||||
Mapping_data (3) | |||||||||
Marked_rearrangement | hT2[unc-54(e190)] | ||||||||
Description | Phenotype | WBPhenotype:0000007 | Paper_evidence | WBPaper00000635 | |||||
Curator_confirmed | WBPerson48 | ||||||||
Remark | No eggs laid, only larvae. | Paper_evidence | WBPaper00000635 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
WBPhenotype:0000349 | Person_evidence | WBPerson261 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | limp paralysed phenotype at all stages; larvae can move slightly more than adults; Egl; muscle ultrastructure very disorganized few thick filaments. ES3 ME0 | Person_evidence | WBPerson261 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
limp paralysed phenotype at all stages | Person_evidence | WBPerson261 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Ease_of_scoring | ES3_Easy_to_score | Person_evidence | WBPerson261 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000640 | Person_evidence | WBPerson261 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Egl | Person_evidence | WBPerson261 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000644 | Paper_evidence | WBPaper00000031 | |||||||
Person_evidence | WBPerson261 | ||||||||
Curator_confirmed (2) | |||||||||
Remark | limp paralysed phenotype at all stages; larvae can move slightly more than adults | Person_evidence | WBPerson261 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000782 | Person_evidence | WBPerson261 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | muscle ultrastructure very disorganized few thick filaments | Person_evidence | WBPerson261 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000861 | Paper_evidence | WBPaper00000031 | |||||||
Curator_confirmed | WBPerson48 | ||||||||
Remark | defect in body muscle cells | Paper_evidence | WBPaper00000031 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
WBPhenotype:0000926 | Paper_evidence | WBPaper00000031 | |||||||
Curator_confirmed | WBPerson48 | ||||||||
Remark | defect in body muscle cells | Paper_evidence | WBPaper00000031 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
WBPhenotype:0001068 | Paper_evidence | WBPaper00000635 | |||||||
Curator_confirmed | WBPerson48 | ||||||||
Phenotype_assay | Treatment | 5 mg/ml serotonin | Paper_evidence | WBPaper00000635 | |||||
Curator_confirmed | WBPerson48 | ||||||||
WBPhenotype:0001292 | Paper_evidence | WBPaper00000031 | |||||||
Curator_confirmed | WBPerson48 | ||||||||
Remark | defect in body muscle cells | Paper_evidence | WBPaper00000031 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
WBPhenotype:0001339 | Paper_evidence | WBPaper00000635 | |||||||
Curator_confirmed | WBPerson48 | ||||||||
Remark | data not shown | Paper_evidence | WBPaper00000635 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
Affected_by | Molecule | WBMol:00004019 | Paper_evidence | WBPaper00000635 | |||||
Curator_confirmed | WBPerson48 | ||||||||
Phenotype_assay | Treatment | 0.1 mg/ml levamisole | Paper_evidence | WBPaper00000635 | |||||
Curator_confirmed | WBPerson48 | ||||||||
WBPhenotype:0001340 | Paper_evidence | WBPaper00000635 | |||||||
Curator_confirmed | WBPerson48 | ||||||||
Phenotype_assay | Treatment | 0.75 mg/ml imipramine | Paper_evidence | WBPaper00000635 | |||||
Curator_confirmed | WBPerson48 | ||||||||
WBPhenotype:0001341 | Paper_evidence | WBPaper00000635 | |||||||
Curator_confirmed | WBPerson48 | ||||||||
Remark | data not shown | Paper_evidence | WBPaper00000635 | ||||||
Curator_confirmed | WBPerson48 | ||||||||
Phenotype_assay | Treatment | 10 mg/ml phentolamine | Paper_evidence | WBPaper00000635 | |||||
Curator_confirmed | WBPerson48 | ||||||||
WBPhenotype:0001930 | Paper_evidence | WBPaper00032907 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Animals were isolated based on altered or fewer muscle arms, observed by an altered pattern of trIs25 reporter expression, which expresses membrane-anchored YFP in select muscles of only the distal row of body wall muscles. | Paper_evidence | WBPaper00032907 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Phenotype_not_observed | WBPhenotype:0000195 | Paper_evidence | WBPaper00005809 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | "Mutations in unc-22 or unc-54 that disrupt the function and structure of body wall muscles (Moerman et al., 1986) had no significant effect on the frequency of DTC migration defects (Table 1; P > 0.3)." | Paper_evidence | WBPaper00005809 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0006865 | PATO:0000460 | Paper_evidence | WBPaper00005809 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
GO_term | GO:0016477 | PATO:0000460 | Paper_evidence | WBPaper00005809 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Genotype | unc-5(e152) | Paper_evidence | WBPaper00005809 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0001236 | Paper_evidence | WBPaper00056554 | |||||||
Curator_confirmed | WBPerson5649 | ||||||||
Remark | expression of mgIs72[rpt-3::gfp] transgene was not increased | Paper_evidence | WBPaper00056554 | ||||||
Curator_confirmed | WBPerson5649 | ||||||||
Phenotype_assay | Control_strain | WBStrain00007961 | Paper_evidence | WBPaper00056554 | |||||
Curator_confirmed | WBPerson5649 | ||||||||
Genotype | mgIs72 [rpt-3::gfp] | Paper_evidence | WBPaper00056554 | ||||||
Curator_confirmed | WBPerson5649 | ||||||||
WBPhenotype:0001426 | Paper_evidence | WBPaper00004883 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Phenotype_assay | Genotype | arIs37 | Paper_evidence | WBPaper00004883 | |||||
Curator_confirmed | WBPerson712 | ||||||||
Reference (33) | |||||||||
Method | Deletion_allele |