WormBase Tree Display for Variation: WBVar00252015
expand all nodes | collapse all nodes | view schema
WBVar00252015 | Name | Public_name | tm3287 | |||||
---|---|---|---|---|---|---|---|---|
Other_name | CE35990:p.Ala175IlefsTer9 | |||||||
K06A1.1.1:c.522_765del | ||||||||
HGVSg | CHROMOSOME_II:g.6455588_6456054del | |||||||
Sequence_details | SMap | S_parent | Sequence | K06A1 | ||||
Flanking_sequences | aagctctacaactaaatatcgggttactgt | cattcccgagaaattggaatctacttgaca | ||||||
Mapping_target | K06A1 | |||||||
Source_location | 7 | CHROMOSOME_II | 6455587 | 6456055 | Inferred_automatically | National_Bioresource_Project | ||
Type_of_mutation | Deletion | |||||||
PCR_product | tm3287_external | |||||||
tm3287_internal | ||||||||
SeqStatus | Sequenced | |||||||
Variation_type | Allele | |||||||
Origin | Species | Caenorhabditis elegans | ||||||
Strain | WBStrain00008309 | |||||||
Laboratory | FX | |||||||
Author | Mitani S | |||||||
DB_info | Database | National_Bioresource_Project | seq | 3287 | ||||
NBP_allele | ||||||||
Status | Live | |||||||
Affects | Gene | WBGene00019424 | ||||||
Transcript | K06A1.1.1 | VEP_consequence | splice_acceptor_variant,splice_donor_variant,frameshift_variant,stop_lost,intron_variant | |||||
VEP_impact | HIGH | |||||||
HGVSc | K06A1.1.1:c.522_765del | |||||||
HGVSp | CE35990:p.Ala175IlefsTer9 | |||||||
cDNA_position | 525-768 | |||||||
CDS_position | 522-765 | |||||||
Protein_position | 174-255 | |||||||
Intron_number | 4-5/7 | |||||||
Exon_number | 4-6/8 | |||||||
Codon_change | gtAGCAGAAATACAAAGACGCATCAGCCCGCCAGAATGCTTAAATGCGTCTCTTCTTGGTGGTATTTTGAGAAAGTAAGAAAGAAGAATAATAAATAATAGTAATAAGTTGTGAGGTTGCAGGGCTAAGTCAAAGGACGGTGGGAAAACATTGAGGGATTCTCTCAAGAAACTTGGTTTGACTCTTCCTGCTGGTAGAAGGAAGCAAGCAAATGTTACAGCTTGGACGGCTTTAGTTGAAGGTTTGTTAAGAGTTTTGGGGAATGGGGTAGGGTTGGTGACGATATAAATTCTTAGGTCCTTAAAATTACAATTCCAACTAATACTTACCAAAATGTCTCTTTAAGAATCCTGAATTTAAGTTCTATTAACGCTCCATAACGCTCGTACTTGTCATGTAAATTTGTTGAATTCCAGAAGAAGCAATTCACATGGCAAAAGAGTTTGCTCTCGTATGTGAAAAGGAATTT/gt | |||||||
Amino_acid_change | VAEIQRRISPPECLNASLLGGILRK*ERRIINNSNKL*GCRAKSKDGGKTLRDSLKKLGLTLPAGRRKQANVTAWTALVEGLLRVLGNGVGLVTI*ILRSLKLQFQLILTKMSL*ES*I*VLLTLHNARTCHVNLLNSRRSNSHGKRVCSRM*KGIX/X | |||||||
Isolation | Mutagen | TMP/UV | ||||||
Genetics | Map | II | ||||||
Description | Phenotype | WBPhenotype:0001524 | Paper_evidence | WBPaper00057148 | ||||
Curator_confirmed | WBPerson712 | |||||||
Remark | these RIS-defective animals were strikingly defective in head movement quiescence and also showed rocking movements: alternating backward and forward body movements, each resulting in less than a half-body translation of the worm's position and virtually no net movement in either direction. | Paper_evidence | WBPaper00057148 | |||||
Curator_confirmed | WBPerson712 | |||||||
Phenotype_not_observed | WBPhenotype:0000062 | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | |||||||
Remark | Classified as homozygous viable by the National Bioresource Project of Japan. | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | |||||||
WBPhenotype:0001524 | Paper_evidence | WBPaper00057148 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Remark | aptf-1(lf) mutants greatly reduced their frequency of body bends during lethargus to a level similar to that of N2 controls. | Paper_evidence | WBPaper00057148 | |||||
Curator_confirmed | WBPerson712 | |||||||
WBPhenotype:0002432 | Paper_evidence | WBPaper00057148 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Remark | In contrast to ALA-defective animals, aptf-1(lf) mutants showed wild type body-bend quiescence during SIS; SIS body movement quiescence in aptf-1(lf) was similar to wild type, but took longer to set in in the case of UV-SIS (G). Body mobility was defined as a translation of the body position by at least 1/10 body length. | Paper_evidence | WBPaper00057148 | |||||
Curator_confirmed | WBPerson712 | |||||||
We examined the behavior of aptf-1(lf) animals during SIS triggered by ultraviolet light (C) and by ingestion of pore-forming Cry5B toxin (D). As in lethargus, RIS-defective animals showed head movement, but they did not rock back and forth as they did during lethargus. Head mobility was defined as any discernible movement. Though head movement is often referred to as foraging behavior, we did not observe any feeding (pharyngeal pumping) in aptf-1 mutants in these assays. | Paper_evidence | WBPaper00057148 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Reference | WBPaper00057148 | |||||||
Remark | 14256/14257-14723/14724 (467 bp deletion) | |||||||
This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. | Paper_evidence | WBPaper00041807 | ||||||
Method | NBP_knockout_allele |