Sequence:
download
WP:CE16043sequence.fasta
>SEL-1 MIKTYLTLLLLATSATCQKKSATLVSAEGEAPAIKVIKTTGSLLTAIDVSKADLDWEQVTSQQDENKSNREIPKVISEEY LAEKVEQPPSPEAEAEFQRGMAYIERGKGHGREGRVAAHRVFERAAAQGHQEARKAVAFSQMFGDYSRWSIQEAKTVFED LEKNGSPDAQLALGFMHGAGIGVEKSNQAKALVYYMFSALGGNPLAQMAMGFRYSHGVGVPQNCETALSYYQKVAKTVVD NVKFTTGQTIQRLRLTDETDPTIHMQPGSAPLESNLLEYYKMLADKGDTSAQLGLGQIYLAGGRGLNQNFELAFRYLLAA AESGSADALTYLGKMYLDGTPFTPKDYQKSFEYLMKSADKSSPSAQAVLGAMYMKGKGVKKNYEKALKLLTLSADKKNAD GQMYLAELHYKGVPTNKGVHRDFKKSVKLYQLASQNGHILAYYNLAQMHAAGTGVPRSCSHAVDLFKSVAERGKWGERLM EAHSAYKDNRVDEAAMKYLFMAELGYEVAQTNLAYILDRGEATSLFSGPKDNNMERAFLNWQRSANQEYAAARVKLGDYY YYGLGTEVDHSLAFSNYKMAVDRHGVAQAMFNLGYMHEVGEGITRDLYLAKRFYDQAIEHSQDAYMPSKLALAKLAFVFY LEELNKLPLISFMEKTVGPRWDAILMTVSALVPLFLFWRHRQNDN
view sequence (685 aa)
>SEL-1
MIKTYLTLLLLATSATCQKKSATLVSAEGEAPAIKVIKTTGSLLTAIDVSKADLDWEQVTSQQDENKSNREIPKVISEEY
LAEKVEQPPSPEAEAEFQRGMAYIERGKGHGREGRVAAHRVFERAAAQGHQEARKAVAFSQMFGDYSRWSIQEAKTVFED
LEKNGSPDAQLALGFMHGAGIGVEKSNQAKALVYYMFSALGGNPLAQMAMGFRYSHGVGVPQNCETALSYYQKVAKTVVD
NVKFTTGQTIQRLRLTDETDPTIHMQPGSAPLESNLLEYYKMLADKGDTSAQLGLGQIYLAGGRGLNQNFELAFRYLLAA
AESGSADALTYLGKMYLDGTPFTPKDYQKSFEYLMKSADKSSPSAQAVLGAMYMKGKGVKKNYEKALKLLTLSADKKNAD
GQMYLAELHYKGVPTNKGVHRDFKKSVKLYQLASQNGHILAYYNLAQMHAAGTGVPRSCSHAVDLFKSVAERGKWGERLM
EAHSAYKDNRVDEAAMKYLFMAELGYEVAQTNLAYILDRGEATSLFSGPKDNNMERAFLNWQRSANQEYAAARVKLGDYY
YYGLGTEVDHSLAFSNYKMAVDRHGVAQAMFNLGYMHEVGEGITRDLYLAKRFYDQAIEHSQDAYMPSKLALAKLAFVFY
LEELNKLPLISFMEKTVGPRWDAILMTVSALVPLFLFWRHRQNDN
Estimated Isoelectric Point:
8.30
Estimated Molecular Weight:
76.3 kD
Amino Acid Composition:
Amino Acid Frequency
Ser43
Phe26
Thr31
Asn26
Lys50
Tyr39
Glu45
Val37
Gln34
Met25
Cys3
Leu70
Ala81
Trp6
Pro21
His17
Asp32
Arg29
Ile18
Gly52