Sequence:
download
SW:Q8BQC8sequence.fasta
>SW:Q8BQC8 MSRSKGPLSFKDVAVAFSQEEWQQLDPEERTTYRDVMLETYSNLVSVGYDVTKPNMIIKLEQGEEPWTVEGDRHAQRHLE ISKVYDPREGIEEIGEKHLQCDDDPYCWRAEKGAAFDEAYTLETALISPSSGAHSCVSCGETLESVSELISSDGSYALEK PSMCFECGKAYGESLEDFNQDEGNSSQHDENILQKVTILEKPFAYECMEALDSESVFMARERAYMGEKPYDWGDSGPDFI QMSDFSTYPRSQMELKPFECTQCGKSFCKKSKFIIHQRAHTGEKPYACSVCGKSFSQKGTLTVHRRSHLEEKPYKCNECG KTFCQKLHLTQHQRTHSGEKPYECSECGKSFCQKTHLTLHQRNHSGERPYPCNECGKSFSRKSALNDHQRTHTGEKLYKC NECGKSYYRKSTLITHQRTHTGEKPYQCSECGKFFSRVSYLTIHYRSHLEEKPYECTECGKTFNLNSAFIRHWKVHAEER VQECGECGKPSPLQCAPDHTGDLGEKRYECNECGKTFLDSSAFHRHQSVPEGEKTYECNICGKSFSDSSCYTVHYRGHSE EKPFGCSECGKTFSHNSSLFRHQRVHTGEKPYECYECGKFFSQKSYLTIHHRIHSGEKPYECSKCGKVFSRMSNLTVHYR SHSGEKPYECNECGKVFSQKSYLTVHYRTHSGEKPYECNECGKKFHHRSAFNSHQRIHKRGTVNVLTVEKL
view sequence (711 aa)
>SW:Q8BQC8
MSRSKGPLSFKDVAVAFSQEEWQQLDPEERTTYRDVMLETYSNLVSVGYDVTKPNMIIKLEQGEEPWTVEGDRHAQRHLE
ISKVYDPREGIEEIGEKHLQCDDDPYCWRAEKGAAFDEAYTLETALISPSSGAHSCVSCGETLESVSELISSDGSYALEK
PSMCFECGKAYGESLEDFNQDEGNSSQHDENILQKVTILEKPFAYECMEALDSESVFMARERAYMGEKPYDWGDSGPDFI
QMSDFSTYPRSQMELKPFECTQCGKSFCKKSKFIIHQRAHTGEKPYACSVCGKSFSQKGTLTVHRRSHLEEKPYKCNECG
KTFCQKLHLTQHQRTHSGEKPYECSECGKSFCQKTHLTLHQRNHSGERPYPCNECGKSFSRKSALNDHQRTHTGEKLYKC
NECGKSYYRKSTLITHQRTHTGEKPYQCSECGKFFSRVSYLTIHYRSHLEEKPYECTECGKTFNLNSAFIRHWKVHAEER
VQECGECGKPSPLQCAPDHTGDLGEKRYECNECGKTFLDSSAFHRHQSVPEGEKTYECNICGKSFSDSSCYTVHYRGHSE
EKPFGCSECGKTFSHNSSLFRHQRVHTGEKPYECYECGKFFSQKSYLTIHHRIHSGEKPYECSKCGKVFSRMSNLTVHYR
SHSGEKPYECNECGKVFSQKSYLTVHYRTHSGEKPYECNECGKKFHHRSAFNSHQRIHKRGTVNVLTVEKL
Estimated Isoelectric Point:
6.81366729736328
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr40
Lys59
Gln29
Leu38
Gly49
Met10
Ser73
Tyr36
His42
Glu76
Arg36
Cys44
Phe32
Pro29
Val27
Asn20
Ala23
Ile19
Trp5
Asp24