Sequence:
download
SW:P70569sequence.fasta
>SW:P70569 MTYSELYSRYTRVWIPDPDEVWRSAELTKDYKDGDESLQLRLEDDTILDYPIDVQNNQVPFLRNPDILVGENDLTALSHL HEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSII VSGESGAGKTVSAKYAMRYFATVGGSASDTNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIEIGFDKKYHIIGANMR TYLLEKSRVVFQADDERNYHIFYQLCAAASLPEFKELALTCAEDFFYTAHGGNTTIEGVDDAEDFEKTRQALTLLGVRES HQISIFKIIASILHLGSVEIQAERDGDSCSISPQDEHLSNFCRLLGIEHSQMEHWLCHRKLVTTSETYVKTMSLQQVVNA RNALAKHIYAQLFSWIVEHINKALQTSLKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMK EQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYERHSNSQHFQKPRMSNTAFIVIHFADKVEYL SDGFLEKNRDTVYEEQINILKASKFPLVADLFRDDEDSVPATNTAKSRSSSKINVRSSRPLMKAPNKEHKKSVGYQFRTS LNLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWTYHDFFNRYRVLMKKRELANT TDKKNICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATIMIQKTVRGWLQRVKYRRLRAATLTLQRFC RGYLARRLTEHLRRTRAAIVFQKQYRMLKARRAYCRVRRAAVIIQSYTRGHVCTQKLPPVLTEHKATIIQKYARGWMARR HFQRQRDAAIVIQCAFRRLKARQALKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSEQLSAVTSTHAME VEKLKKELARYQQNQEADPSLQLQEEVQSLRTELQKAHSERRVLEDAHNRENGELRKRVADLEHENALLKDEKEHLNHQI LRQSKAESSQSSVEENLLIKKELEEERSRYQNLVKEYSQLEQRYENLRDEQQTPGHRKNPSNQSSLESDSNYPSISTSEI GDTEDALQQVEEIGIEKAAMDMTVFLKLQKRVRELEQERKKLQVQLEKEQQDSKKVQVEQQNNGLDVDQDADIAYNSLKR QELESENKKLKNDLNERWKAVADQAMQDNSTHSSPDSYSLLLNQLKLANEELEVRKEEVLILRTQIMNADQRRLSGKNME PNINARTSWPNSEKHVDQEDAIEAYHGVCQTNSQTEDWGYLNEDGELGLAYQGLKQVARLLEAQLQAQNLKHEEEVEHLK AQVEAMKEEMDKQQQTFCQTLLLSPEAQVEFGVQQEISRLTNENLDFKELVEKLEKNEKKLKKQLKIYMKKVQDLEAAQA LAQSDRRHHELTRQVTVQRKEKDFQGMLEYHKEDEALLIRNLVTDLKPQMLSGTVPCLPAYILYMCIRHADYTNDDLKVH SLLSSTINGIKKVLKKHNEDFEMTSFWLSNTCRLLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIY QQLIKIAEGLLQPMIVSAMLENESIQGLSGVRPTGYRKRSSSMVDGENSYCLEAIIRQMNFFHTVLCDQGLDPEIILQVF KQLFYMINAVTLNNLLLRKDACSWSTGMQLRYNISQLEEWLRGKNLQQSGAVQTMEPLIQAAQLLQLKKKTQEDAEAICS LCTSLSTQQIVKILNLYTPLNGFEERVTVSFIRTIQAQLQERSDPQQLLLDSKHMFPVLFPFNPSALTMDSIHIPACLNL EFLNEV
view sequence (1846 aa)
>SW:P70569
MTYSELYSRYTRVWIPDPDEVWRSAELTKDYKDGDESLQLRLEDDTILDYPIDVQNNQVPFLRNPDILVGENDLTALSHL
HEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSII
VSGESGAGKTVSAKYAMRYFATVGGSASDTNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIEIGFDKKYHIIGANMR
TYLLEKSRVVFQADDERNYHIFYQLCAAASLPEFKELALTCAEDFFYTAHGGNTTIEGVDDAEDFEKTRQALTLLGVRES
HQISIFKIIASILHLGSVEIQAERDGDSCSISPQDEHLSNFCRLLGIEHSQMEHWLCHRKLVTTSETYVKTMSLQQVVNA
RNALAKHIYAQLFSWIVEHINKALQTSLKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMK
EQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYERHSNSQHFQKPRMSNTAFIVIHFADKVEYL
SDGFLEKNRDTVYEEQINILKASKFPLVADLFRDDEDSVPATNTAKSRSSSKINVRSSRPLMKAPNKEHKKSVGYQFRTS
LNLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWTYHDFFNRYRVLMKKRELANT
TDKKNICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATIMIQKTVRGWLQRVKYRRLRAATLTLQRFC
RGYLARRLTEHLRRTRAAIVFQKQYRMLKARRAYCRVRRAAVIIQSYTRGHVCTQKLPPVLTEHKATIIQKYARGWMARR
HFQRQRDAAIVIQCAFRRLKARQALKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSEQLSAVTSTHAME
VEKLKKELARYQQNQEADPSLQLQEEVQSLRTELQKAHSERRVLEDAHNRENGELRKRVADLEHENALLKDEKEHLNHQI
LRQSKAESSQSSVEENLLIKKELEEERSRYQNLVKEYSQLEQRYENLRDEQQTPGHRKNPSNQSSLESDSNYPSISTSEI
GDTEDALQQVEEIGIEKAAMDMTVFLKLQKRVRELEQERKKLQVQLEKEQQDSKKVQVEQQNNGLDVDQDADIAYNSLKR
QELESENKKLKNDLNERWKAVADQAMQDNSTHSSPDSYSLLLNQLKLANEELEVRKEEVLILRTQIMNADQRRLSGKNME
PNINARTSWPNSEKHVDQEDAIEAYHGVCQTNSQTEDWGYLNEDGELGLAYQGLKQVARLLEAQLQAQNLKHEEEVEHLK
AQVEAMKEEMDKQQQTFCQTLLLSPEAQVEFGVQQEISRLTNENLDFKELVEKLEKNEKKLKKQLKIYMKKVQDLEAAQA
LAQSDRRHHELTRQVTVQRKEKDFQGMLEYHKEDEALLIRNLVTDLKPQMLSGTVPCLPAYILYMCIRHADYTNDDLKVH
SLLSSTINGIKKVLKKHNEDFEMTSFWLSNTCRLLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIY
QQLIKIAEGLLQPMIVSAMLENESIQGLSGVRPTGYRKRSSSMVDGENSYCLEAIIRQMNFFHTVLCDQGLDPEIILQVF
KQLFYMINAVTLNNLLLRKDACSWSTGMQLRYNISQLEEWLRGKNLQQSGAVQTMEPLIQAAQLLQLKKKTQEDAEAICS
LCTSLSTQQIVKILNLYTPLNGFEERVTVSFIRTIQAQLQERSDPQQLLLDSKHMFPVLFPFNPSALTMDSIHIPACLNL
EFLNEV
Estimated Isoelectric Point:
6.52570343017578
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr88
Lys133
Gln140
Leu202
Gly64
Met41
Ser119
Tyr64
His53
Glu162
Arg112
Cys29
Phe63
Pro49
Val97
Asn94
Ala124
Ile101
Trp15
Asp96