Sequence:
download
SW:P21271sequence.fasta
>SW:P21271 MSYSELYTRYTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDDTILEYPVDVQNNQVPFLRNPDILVGENDLTALSHL HEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSII VSGESGAGKTVSAKYAMRYFATVGGSASDTNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKFIEIGFDKKYHIIGANMR TYLLEKSRVVFQADDERNYHIFYQLCAAASLPEFKELALTCAEDFFYTAHGGNTTIEGVNDADDFEKTRQALTLLGVRDS HQISIFKIIASILHLGSVEIQSERDGDSCSISPQDEHLSNFCSLLGIEHSQMEHWLCHRKLVTTSETYVKTMSLQQVVNA RDALAKHIYAQLFSWIVEHINKALHTSHKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMK EQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYERHSNSQHFQKPRMSNTAFIVNHFADKVEYL SDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDSAPATNTAKNRSSSKINVRSSRPLIKVPNKEHKKSVGYQFRTS LNLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWTYHDFFNRYRVLMKKRELTNT DKKNICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCR GYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKR FLRERDAAIVIQCAFRRLKARQELKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSEQLSAVTSSHAVEV EKLKKELAHYQQNQEADTSLQLQEEVQSLRTELQKAHSERRVLEDAHNKENGELRKRVADLEHENALLKDEKEYLNNQIL CQSKAESSQSSVEENLLMKKELEEERSRYQNLVKEYSQLEQRYENLRDEQTPGHRKNPSNQSSLESDSNYPSISTSEIGD TEDALQQVEEIGIEKAAMDMTVFLKLQKRVRELEQERKKLQAQLEKGQQDSKKGQVEQQNNGLDVDQDADIAYNSLKRQE LESENKKLKNDLNELRKAVADQAMQDNSTHSSPDSYSLLLNQLKLANEELEVRKEEVLILRTQIMNADQRRLSGKNMEPN INARTSWPNSEKHVDQEDAIEAYHGVCQTNRLLEAQLQAQSLEHEEEVEHLKAQVEALKEEMDKQQQTFCQTLLLSPEAQ VEFGVQQEISRLTNENLDFKELVEKLEKNERKLKKQLKIYMKKVQDLEAAQALAQSDRRHHELTRQVTVQRKEKDFQGML EYHKEDEALLIRNLVTDLKPQMLSGTVPCLPAYILYMCIRHADYTNDDLKVHSLLSSTINGIKKVLKKHNDDFEMTSFWL SNTCRFLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIKIAEGLLQPMIVSAMLENESIQGL SGVRPTGYRKRSSSMVDGENSYCLEAIVRQMNSFHTVLCDQGLDPEIILQVFKQLFYMINAVTLNNLLLRKDACSWSTGM QLRYNISQLEEWLRGKNLHQSGAVQTMEPLIQAAQLLQLKKKTHEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVT VSFIRTIQAQLQERNDPQQLLLDSKHVFPVLFPYNPSALTMDSIHIPACLNLEFLNEV
view sequence (1818 aa)
>SW:P21271
MSYSELYTRYTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDDTILEYPVDVQNNQVPFLRNPDILVGENDLTALSHL
HEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSII
VSGESGAGKTVSAKYAMRYFATVGGSASDTNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKFIEIGFDKKYHIIGANMR
TYLLEKSRVVFQADDERNYHIFYQLCAAASLPEFKELALTCAEDFFYTAHGGNTTIEGVNDADDFEKTRQALTLLGVRDS
HQISIFKIIASILHLGSVEIQSERDGDSCSISPQDEHLSNFCSLLGIEHSQMEHWLCHRKLVTTSETYVKTMSLQQVVNA
RDALAKHIYAQLFSWIVEHINKALHTSHKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMK
EQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYERHSNSQHFQKPRMSNTAFIVNHFADKVEYL
SDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDSAPATNTAKNRSSSKINVRSSRPLIKVPNKEHKKSVGYQFRTS
LNLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWTYHDFFNRYRVLMKKRELTNT
DKKNICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCR
GYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKR
FLRERDAAIVIQCAFRRLKARQELKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSEQLSAVTSSHAVEV
EKLKKELAHYQQNQEADTSLQLQEEVQSLRTELQKAHSERRVLEDAHNKENGELRKRVADLEHENALLKDEKEYLNNQIL
CQSKAESSQSSVEENLLMKKELEEERSRYQNLVKEYSQLEQRYENLRDEQTPGHRKNPSNQSSLESDSNYPSISTSEIGD
TEDALQQVEEIGIEKAAMDMTVFLKLQKRVRELEQERKKLQAQLEKGQQDSKKGQVEQQNNGLDVDQDADIAYNSLKRQE
LESENKKLKNDLNELRKAVADQAMQDNSTHSSPDSYSLLLNQLKLANEELEVRKEEVLILRTQIMNADQRRLSGKNMEPN
INARTSWPNSEKHVDQEDAIEAYHGVCQTNRLLEAQLQAQSLEHEEEVEHLKAQVEALKEEMDKQQQTFCQTLLLSPEAQ
VEFGVQQEISRLTNENLDFKELVEKLEKNERKLKKQLKIYMKKVQDLEAAQALAQSDRRHHELTRQVTVQRKEKDFQGML
EYHKEDEALLIRNLVTDLKPQMLSGTVPCLPAYILYMCIRHADYTNDDLKVHSLLSSTINGIKKVLKKHNDDFEMTSFWL
SNTCRFLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIKIAEGLLQPMIVSAMLENESIQGL
SGVRPTGYRKRSSSMVDGENSYCLEAIVRQMNSFHTVLCDQGLDPEIILQVFKQLFYMINAVTLNNLLLRKDACSWSTGM
QLRYNISQLEEWLRGKNLHQSGAVQTMEPLIQAAQLLQLKKKTHEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVT
VSFIRTIQAQLQERNDPQQLLLDSKHVFPVLFPYNPSALTMDSIHIPACLNLEFLNEV
Estimated Isoelectric Point:
6.66819000244141
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr83
Lys133
Gln131
Leu198
Gly60
Met40
Ser123
Tyr63
His55
Glu159
Arg111
Cys29
Phe65
Pro46
Val98
Asn97
Ala121
Ile98
Trp13
Asp95