Sequence:
download
SW:B1AWN4sequence.fasta
>SW:B1AWN4 MTCSLDFSWLRWKWRTQDGFSQSPSETTPLLSPETDRQSHNTAEQRVVYPNNSMCHQDWKKVCRRYPGNSICTTKYTLLT FLPQNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITIFPLATVLLIIMVKDGIEDFKRYCFDREMNSASIQIYERKEQ RYMLKRWQDVRVGDFVQMQCNEIVPADILLLFSSDPSGVCHLETANLDGETNLKQRRVVKGFSQPEVQFQPEHFHSTIVC EKPNNHLSKFKGYMEHPDQTRTGFGSESLLLRGCTIRNTEVAAGIVIYAGHETKAMLNNSGPRYKRSKIERRINTDIFFC IGLLFLMCLIGAVGHSLWNGTFKEHPPFDVPDADGNFLSLALGGFYMFLTMIILLQVLIPISLYVSIELVKLGQVFLLHN DLDLYDEETDLSIQCRALNITEDLGQIQYIFSDKTGTLTENKMVFRRCTIVGSEYCHQENAKRLEMPKELDSDGEEWTQY QCLSFPPRWAQGSTTMRSQGGAQPLRRCHSARVPIQSHCRQRSVGRWETSQPPVAFSSSIEKDVTPDKNLLSKVRDAALW LETSDTRPAKPSHSTTASIADFFLALTICNSVMVSTTTEPRKRVTTPPANKALGTSLEKIQQLFQRLKLLSLSQSFSSTA PSDTDLGESLGPNLPTIDSDEKDDTSVCSGDCSTDGGYRSSTWEQGDILGSESGTSLEEGLEAPTLSQDEPELCYEAESP DEAALVHAARAYSFTLVSRTPEQVTVRLPQGICLTFDLLFTLGFDSVRKRMSVVVRHPLTDEIIVYTKGADSVIMDLLED PACESNIDVEKKLKRIRARTQKHLDLYARDGLRTLCIAKKVVDEEDFQRWASFRREAEASLDNREELLMETAQHLENHLT LLGATGIEDRLQEGVPDTIAALREAGIQLWVLTGDKQETAVNIAYSCKLLDQTDTVYSINTENQETCESILNCTLEDIKR FHEPQQPARKLCGHRIPPKMPSVNSGAMAPEIGLVIDGKTLNAIFQGKLENKFLELTQYCRSVLCCRSTPLQKSMIVKLV RDKLSVMTLSIGDGANDVSMIQAADIGIGISGQEGMQAVMSSDFAIARFSHLKKLLLVHGHWCYSRLARMVVYYFYKNVC YVNLLFWYQFFCGFSGSTMIDYWQMIFFNLFFTSLPPIIFGVLDKDVSAETLLALPELYKSGQNSECYNLPTFWVSMADA FYQSLICFFIPYLTYRGSDIDVFTFGTPINTISLTTILLHQAMEMKTWTVLHGLVLLGSFLMYFVVSLIYNATCVTCNSP TNPYWVMERQLSDPTFYLICLLTPVVALLPRYFLLSLQGTYGKSLISKAQKIDKLPIDKRNLEIQNWRSKQRPAPASASA SASAPATGTVHTRPPCHPVPPEAQQNFGASTSKSSGPPRQKHVEDRVLQDPRCSREHSRDDTCTVDTLAKLSSGECLLDP NRTVAPTAYSRGQKDVSRHSSKGSHRRSQSSLTI
view sequence (1474 aa)
>SW:B1AWN4
MTCSLDFSWLRWKWRTQDGFSQSPSETTPLLSPETDRQSHNTAEQRVVYPNNSMCHQDWKKVCRRYPGNSICTTKYTLLT
FLPQNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITIFPLATVLLIIMVKDGIEDFKRYCFDREMNSASIQIYERKEQ
RYMLKRWQDVRVGDFVQMQCNEIVPADILLLFSSDPSGVCHLETANLDGETNLKQRRVVKGFSQPEVQFQPEHFHSTIVC
EKPNNHLSKFKGYMEHPDQTRTGFGSESLLLRGCTIRNTEVAAGIVIYAGHETKAMLNNSGPRYKRSKIERRINTDIFFC
IGLLFLMCLIGAVGHSLWNGTFKEHPPFDVPDADGNFLSLALGGFYMFLTMIILLQVLIPISLYVSIELVKLGQVFLLHN
DLDLYDEETDLSIQCRALNITEDLGQIQYIFSDKTGTLTENKMVFRRCTIVGSEYCHQENAKRLEMPKELDSDGEEWTQY
QCLSFPPRWAQGSTTMRSQGGAQPLRRCHSARVPIQSHCRQRSVGRWETSQPPVAFSSSIEKDVTPDKNLLSKVRDAALW
LETSDTRPAKPSHSTTASIADFFLALTICNSVMVSTTTEPRKRVTTPPANKALGTSLEKIQQLFQRLKLLSLSQSFSSTA
PSDTDLGESLGPNLPTIDSDEKDDTSVCSGDCSTDGGYRSSTWEQGDILGSESGTSLEEGLEAPTLSQDEPELCYEAESP
DEAALVHAARAYSFTLVSRTPEQVTVRLPQGICLTFDLLFTLGFDSVRKRMSVVVRHPLTDEIIVYTKGADSVIMDLLED
PACESNIDVEKKLKRIRARTQKHLDLYARDGLRTLCIAKKVVDEEDFQRWASFRREAEASLDNREELLMETAQHLENHLT
LLGATGIEDRLQEGVPDTIAALREAGIQLWVLTGDKQETAVNIAYSCKLLDQTDTVYSINTENQETCESILNCTLEDIKR
FHEPQQPARKLCGHRIPPKMPSVNSGAMAPEIGLVIDGKTLNAIFQGKLENKFLELTQYCRSVLCCRSTPLQKSMIVKLV
RDKLSVMTLSIGDGANDVSMIQAADIGIGISGQEGMQAVMSSDFAIARFSHLKKLLLVHGHWCYSRLARMVVYYFYKNVC
YVNLLFWYQFFCGFSGSTMIDYWQMIFFNLFFTSLPPIIFGVLDKDVSAETLLALPELYKSGQNSECYNLPTFWVSMADA
FYQSLICFFIPYLTYRGSDIDVFTFGTPINTISLTTILLHQAMEMKTWTVLHGLVLLGSFLMYFVVSLIYNATCVTCNSP
TNPYWVMERQLSDPTFYLICLLTPVVALLPRYFLLSLQGTYGKSLISKAQKIDKLPIDKRNLEIQNWRSKQRPAPASASA
SASAPATGTVHTRPPCHPVPPEAQQNFGASTSKSSGPPRQKHVEDRVLQDPRCSREHSRDDTCTVDTLAKLSSGECLLDP
NRTVAPTAYSRGQKDVSRHSSKGSHRRSQSSLTI
Estimated Isoelectric Point:
6.15966033935547
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr105
Lys67
Gln71
Leu160
Gly77
Met35
Ser128
Tyr43
His35
Glu86
Arg84
Cys43
Phe67
Pro75
Val84
Asn51
Ala81
Ile79
Trp22
Asp81