Sequence:
download
SRP05421sequence.fasta
>SRAE_X000005100 MKIIINLWRNILIFIILFLSFFLIYSQIPCGKSFVSCENSIFERKNAIDYNIIEGHIYKIDGSVTTTLTSNTNKILIDED MILTASHQAEMALLNNMKEKKFIDKPNDKLIKDSIMRYIEVTSQEYQKNNLINGSNLNTALSKELKTMGLNLVDLKIIKI PENISNIMSEICIKNKKNFCTPSSYRTINGECNNVNNPTLGSVYEPFQRILSPDYEDYIMLPRSSYKKEQLPNERELTTK LFNYKNDRNVTISNLFAYWFHLISSDISLISSITKTSSGEDIIPQCCSPNTKKMDNECDPLEISSSDSIYRGLVTCIPYT RSIPTIPKNCNLGQREQANFVTSYIDGSSIYGISINNEKELREYVNGKLKTVIFNNDSELLSADITTSEWCQLSSNYSCF KTGTKDGNIFPGSSTLRTILVKYHNYIAINLKKLNPFWDDEKIYQESKKIIIGKIQFITYNEFLPILLGEKNMIKYKLKL RNYGYESNYDITINSNVFNEVSILLNPLLFSMINEMIRLVDNKGWIIKNFNIGDTFNDPSLLYEKDGIENIIRFLTLEKI NPPSLLIPEIFKSYYLSKRGNFGLDSISLAIKKGRDHGIKGYRFYRQACGLSDITNFNDLEKIFYSKDVVNILSSLYDNI NDVELIIGSLGEKPIDGSLLGPTLSCILGKQFEILKYGDRYWFENYFTDSSFTIKQLDEIRKSSISEIICVGSNINSLQP NTFLLPDKFSNTFLNCNNNAINKMKFKYWKDDEKKIEIPITKETIEKVFDLAELNVKERIKRELKNINVNQTNFQKGDPL YAWSNMLRPKERSKEIGKIAEILLESTKILINNNNLPGGEKLPKLSIEHIQKMLPEIDVSRFIFNYTAFLSDNGRLTKDQ CLPQNLPCDHTNKYRIYSGWCNNLKHPEYGNAFQPLKHLLTPVYDDGFDKPRIKSITGKLLPNPRIISNKIHEDKNISHV KFTHMVMQFGQFLDHDLTHSPTSRGPNNEILNCTRCDSPETISVHCSPIPIEIGDPHFPTHYPNGEKRCLPFARSLLGQL NLGYRNQLNQLTSFIDGSAIYGSTDCEANQLRFFSKGLLKYSNIGLHNTEALPQGEQEKDCRSLPKYKCFVSGDERNSHQ PGLTMMHTIFMREHNRIVKKLSIINPHWNDEKLYQEGRRIQIGQFQHIVFSEFIPKIIGIKLLDKYDIMVKKDGYYKKYD ETCDPQISQPFATAAYRFGHTLIRRLFPRLDKNFKEISDPIDISTHFGHVEPIYNGTAGGIDSIIMGLLGTPSMAFDRHI TSAVRNHLFARRGEKTSGMDLIAINILRARDHGVQSYNTFREFCGFKKATNFNDLLNDMDSETVFSLQSVYEDVNDIDLF PGLISEKPLRGALLGPTMACLIAEQFSRLKKCDRYYYENNNEVTKFTLRQLREIRKIKLSTIFCQNSNYIKTIQPNVFDM PDDLMNSLVDCENLGKINLNEWKEDLSCQIKDKEIELGKTIDITPCVSCTCTKDGTICHPKKIINCEKLLSMFSKNEILN DTSCIIQCSILLKK
view sequence (1534 aa)
>SRAE_X000005100
MKIIINLWRNILIFIILFLSFFLIYSQIPCGKSFVSCENSIFERKNAIDYNIIEGHIYKIDGSVTTTLTSNTNKILIDED
MILTASHQAEMALLNNMKEKKFIDKPNDKLIKDSIMRYIEVTSQEYQKNNLINGSNLNTALSKELKTMGLNLVDLKIIKI
PENISNIMSEICIKNKKNFCTPSSYRTINGECNNVNNPTLGSVYEPFQRILSPDYEDYIMLPRSSYKKEQLPNERELTTK
LFNYKNDRNVTISNLFAYWFHLISSDISLISSITKTSSGEDIIPQCCSPNTKKMDNECDPLEISSSDSIYRGLVTCIPYT
RSIPTIPKNCNLGQREQANFVTSYIDGSSIYGISINNEKELREYVNGKLKTVIFNNDSELLSADITTSEWCQLSSNYSCF
KTGTKDGNIFPGSSTLRTILVKYHNYIAINLKKLNPFWDDEKIYQESKKIIIGKIQFITYNEFLPILLGEKNMIKYKLKL
RNYGYESNYDITINSNVFNEVSILLNPLLFSMINEMIRLVDNKGWIIKNFNIGDTFNDPSLLYEKDGIENIIRFLTLEKI
NPPSLLIPEIFKSYYLSKRGNFGLDSISLAIKKGRDHGIKGYRFYRQACGLSDITNFNDLEKIFYSKDVVNILSSLYDNI
NDVELIIGSLGEKPIDGSLLGPTLSCILGKQFEILKYGDRYWFENYFTDSSFTIKQLDEIRKSSISEIICVGSNINSLQP
NTFLLPDKFSNTFLNCNNNAINKMKFKYWKDDEKKIEIPITKETIEKVFDLAELNVKERIKRELKNINVNQTNFQKGDPL
YAWSNMLRPKERSKEIGKIAEILLESTKILINNNNLPGGEKLPKLSIEHIQKMLPEIDVSRFIFNYTAFLSDNGRLTKDQ
CLPQNLPCDHTNKYRIYSGWCNNLKHPEYGNAFQPLKHLLTPVYDDGFDKPRIKSITGKLLPNPRIISNKIHEDKNISHV
KFTHMVMQFGQFLDHDLTHSPTSRGPNNEILNCTRCDSPETISVHCSPIPIEIGDPHFPTHYPNGEKRCLPFARSLLGQL
NLGYRNQLNQLTSFIDGSAIYGSTDCEANQLRFFSKGLLKYSNIGLHNTEALPQGEQEKDCRSLPKYKCFVSGDERNSHQ
PGLTMMHTIFMREHNRIVKKLSIINPHWNDEKLYQEGRRIQIGQFQHIVFSEFIPKIIGIKLLDKYDIMVKKDGYYKKYD
ETCDPQISQPFATAAYRFGHTLIRRLFPRLDKNFKEISDPIDISTHFGHVEPIYNGTAGGIDSIIMGLLGTPSMAFDRHI
TSAVRNHLFARRGEKTSGMDLIAINILRARDHGVQSYNTFREFCGFKKATNFNDLLNDMDSETVFSLQSVYEDVNDIDLF
PGLISEKPLRGALLGPTMACLIAEQFSRLKKCDRYYYENNNEVTKFTLRQLREIRKIKLSTIFCQNSNYIKTIQPNVFDM
PDDLMNSLVDCENLGKINLNEWKEDLSCQIKDKEIELGKTIDITPCVSCTCTKDGTICHPKKIINCEKLLSMFSKNEILN
DTSCIIQCSILLKK
Estimated Isoelectric Point:
8.18982696533203
Estimated Molecular Weight:
176.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr81
Lys129
Gln45
Leu149
Gly78
Met29
Ser120
Tyr61
His30
Glu92
Arg60
Cys40
Phe75
Pro68
Val41
Asn132
Ala34
Ile171
Trp11
Asp88