Sequence:
download
SGD:YPR109Wsequence.fasta
>YPR109W MDNFESTAEGNLSIGNKRVYELRKRNFQRNLVNNLSFLGYVLISLEYIKYDRTVWTLITRAIVQSLISSPFPSDAKLRRL ATLGADNNTTGVATLPGGRSIRFPGMFGTEMLYNSSSEAEQQDHDDTAIVSMKKQIRKFLFHGCLSLNMLFIILTILFPI DFFEPLSGSEPVDDGPKNTPSPFSNSDGLLLGERRGGLFLQMIGERLPKSNFSGNLGLVMFEFSILIVQFTLFSLTCVVL ADLDFEEPERLEPVNSDGYDGSVIVARIPLNKTMNAILNDGNINDNNENASNSV
view sequence (295 aa)
>YPR109W
MDNFESTAEGNLSIGNKRVYELRKRNFQRNLVNNLSFLGYVLISLEYIKYDRTVWTLITRAIVQSLISSPFPSDAKLRRL
ATLGADNNTTGVATLPGGRSIRFPGMFGTEMLYNSSSEAEQQDHDDTAIVSMKKQIRKFLFHGCLSLNMLFIILTILFPI
DFFEPLSGSEPVDDGPKNTPSPFSNSDGLLLGERRGGLFLQMIGERLPKSNFSGNLGLVMFEFSILIVQFTLFSLTCVVL
ADLDFEEPERLEPVNSDGYDGSVIVARIPLNKTMNAILNDGNINDNNENASNSV
Estimated Isoelectric Point:
4.93656158447266
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys10
Gln7
Leu37
Gly22
Met8
Ser27
Tyr6
His2
Glu17
Arg16
Cys2
Phe20
Pro14
Val16
Asn25
Ala12
Ile20
Trp1
Asp17