Sequence:
download
SGD:YPL272Csequence.fasta
>PBI1 MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLTLPLIATTLKRLIKSQPA LFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHG HDVLFDIFSAANFHKLFLKELNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLK PLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECPLSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVT KHVSGFIMAKLRSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTL MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE
view sequence (518 aa)
>PBI1
MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLTLPLIATTLKRLIKSQPA
LFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHG
HDVLFDIFSAANFHKLFLKELNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY
YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLK
PLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECPLSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVT
KHVSGFIMAKLRSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTL
MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE
Estimated Isoelectric Point:
5.64087677001953
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys34
Gln14
Leu56
Gly19
Met9
Ser51
Tyr15
His15
Glu31
Arg19
Cys9
Phe37
Pro18
Val24
Asn39
Ala15
Ile37
Trp5
Asp35