Sequence:
download
SGD:YOR356Wsequence.fasta
>CIR2 MIKFTNENLIRGIRMTISAKSRHLALGTDMTRKFSLSCRFLNKANLTEEEKELLNEPRARDYVDVCIVGGGPAGLATAIK LKQLDNSSGTGQLRVVVLEKSSVLGGQTVSGAILEPGVWKELFPDEKSDIGIPLPKELATLVTKEHLKFLKGKWAISVPE PSQMINKGRNYIVSLNQVVGYLGEKAEEVGVEVYPGIAVSDLIYDENNAVKGVITKDAGISKSGKPKETFERGMEFWARQ TVLAEGCHGSLTKQALAKYDLRKGRQHQTYGLGIKEVWEVKPENFNKGFAAHTMGYPLTNDVYGGGFQYHFGDGLVTVGL VVGLDYKNPYVSPYKEFQKMKHHPYYSKVLEGGKCIAYAARALNEGGLQSVPKLNFPGGVLVGASAGFMNVPKIKGTHTA MKSGLLAAESIFESIKGLPVLEEVEDEDAKMAMFDKEATINLESYESAFKESSIYKELYEVRNIRPSFSGKLGGYGGMIY SGIDSLILKGKVPWTLKFDEKNDGEILEPASKYKPIEYPKPDGVISFDILTSVSRTGTYHDDDEPCHLRVPGQDMVKYAE RSFPVWKGVESRFCPAGVYEFVKDEKSPVGTRLQINSQNCIHCKTCDIKAPRQDITWKVPEGGDGPKYTLT
view sequence (632 aa)
>CIR2
MIKFTNENLIRGIRMTISAKSRHLALGTDMTRKFSLSCRFLNKANLTEEEKELLNEPRARDYVDVCIVGGGPAGLATAIK
LKQLDNSSGTGQLRVVVLEKSSVLGGQTVSGAILEPGVWKELFPDEKSDIGIPLPKELATLVTKEHLKFLKGKWAISVPE
PSQMINKGRNYIVSLNQVVGYLGEKAEEVGVEVYPGIAVSDLIYDENNAVKGVITKDAGISKSGKPKETFERGMEFWARQ
TVLAEGCHGSLTKQALAKYDLRKGRQHQTYGLGIKEVWEVKPENFNKGFAAHTMGYPLTNDVYGGGFQYHFGDGLVTVGL
VVGLDYKNPYVSPYKEFQKMKHHPYYSKVLEGGKCIAYAARALNEGGLQSVPKLNFPGGVLVGASAGFMNVPKIKGTHTA
MKSGLLAAESIFESIKGLPVLEEVEDEDAKMAMFDKEATINLESYESAFKESSIYKELYEVRNIRPSFSGKLGGYGGMIY
SGIDSLILKGKVPWTLKFDEKNDGEILEPASKYKPIEYPKPDGVISFDILTSVSRTGTYHDDDEPCHLRVPGQDMVKYAE
RSFPVWKGVESRFCPAGVYEFVKDEKSPVGTRLQINSQNCIHCKTCDIKAPRQDITWKVPEGGDGPKYTLT
Estimated Isoelectric Point:
7.88135528564453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys59
Gln16
Leu53
Gly65
Met13
Ser40
Tyr27
His12
Glu50
Arg22
Cys9
Phe23
Pro33
Val48
Asn23
Ala37
Ile35
Trp7
Asp29