Sequence:
download
SGD:YOR072Wsequence.fasta
>YOR072W MLTKVVFLFFWSRSDSTKKLAACNHATLAHYILTPALYSDACAIYSDVYSITIIVVATVVRNPARCSLRARKFCRLFSSF FQFHYLKELFYFIRKPDDKFSSFI
view sequence (105 aa)
>YOR072W
MLTKVVFLFFWSRSDSTKKLAACNHATLAHYILTPALYSDACAIYSDVYSITIIVVATVVRNPARCSLRARKFCRLFSSF
FQFHYLKELFYFIRKPDDKFSSFI
Estimated Isoelectric Point:
9.60999298095703
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys7
Gln1
Leu10
Met1
Ser11
Tyr6
His3
Glu1
Arg7
Cys4
Phe12
Pro3
Val7
Asn2
Ala10
Ile7
Trp1
Asp5