Sequence:
download
SGD:YNL052Wsequence.fasta
>COX5A MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEW GPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK
view sequence (154 aa)
>COX5A
MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEW
GPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK
Estimated Isoelectric Point:
9.81699371337891
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys11
Gln11
Leu13
Gly12
Met5
Ser15
Tyr4
His1
Glu8
Arg9
Phe5
Pro6
Val10
Asn7
Ala14
Ile4
Trp6
Asp5