Sequence:
download
SGD:YMR201Csequence.fasta
>RAD14 MTPEQKAKLEANRKLAIERLRKRGILSSDQLNRIESRNEPLKTRPLAVTSGSNRDDNAAAAVHVPNHNGQPSALANTNTN TTSLYGSGVVDGSKRDASVLDKRPTDRIRPSIRKQDYIEYDFATMQNLNGGYINPKDKLPNSDFTDDQEFESEFGSKKQK TLQDWKKEQLERKMLYENAPPPEHISKAPKCIECHINIEMDPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYFLTD PELNDEDLFHRLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGLDEEWQRREEGKAHRREKKYEKKIKEMRLKTRAQ EYTNRLREKKHGKAHIHHFSDPVDGGIDEDGYQIQRRRCTDCGLETEEIDI
view sequence (372 aa)
>RAD14
MTPEQKAKLEANRKLAIERLRKRGILSSDQLNRIESRNEPLKTRPLAVTSGSNRDDNAAAAVHVPNHNGQPSALANTNTN
TTSLYGSGVVDGSKRDASVLDKRPTDRIRPSIRKQDYIEYDFATMQNLNGGYINPKDKLPNSDFTDDQEFESEFGSKKQK
TLQDWKKEQLERKMLYENAPPPEHISKAPKCIECHINIEMDPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYFLTD
PELNDEDLFHRLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGLDEEWQRREEGKAHRREKKYEKKIKEMRLKTRAQ
EYTNRLREKKHGKAHIHHFSDPVDGGIDEDGYQIQRRRCTDCGLETEEIDI
Estimated Isoelectric Point:
6.90702056884766
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys37
Gln16
Leu28
Gly19
Met6
Ser18
Tyr10
His13
Glu39
Arg28
Cys8
Phe12
Pro19
Val12
Asn19
Ala21
Ile17
Trp3
Asp27