Sequence:
download
SGD:YML102Wsequence.fasta
>CAC2 MEASHLQIYWHDSQPVYSLTFQKNSANDKLFTAGGDNKVRIWKLNRDENGQNGGVRKIESLDFLGSLTHHEQAINVIRFN SKGDVLASAGDDGQVLLWKQEDPNTQQESVVRPFGMDAETSEADENKEKWVVWKRLRGGSGATAAAEIYDLAWSPDNRNI VVACMDNSIRLFDVGAGMLVCGQSDHGHYVQGVAWDPLNQFILSQSADRSLHVYGVILSSAGVVTGLKLRSKIAKAELPC PGDVLRTNYLFHNETLPSFFRRCSISPCGGLVVIPSGVYKVAGDEVANCVYVYTRSGILNSAGGVKNRPAIRIPSLKKPA LMAAFSPVFYETCQKSVLKLPYKLVFAIATTNEVLVYDTDVLEPLCVVGNIHYSPITDLAWSEDGSTLLISSTDGFCSYV SIDTETQFGSRIEPPAMHAEPLDTDESAVAAKNQREAGGIVNMLPVKKIPCNSSDSKKRRIHPTPVDL
view sequence (469 aa)
>CAC2
MEASHLQIYWHDSQPVYSLTFQKNSANDKLFTAGGDNKVRIWKLNRDENGQNGGVRKIESLDFLGSLTHHEQAINVIRFN
SKGDVLASAGDDGQVLLWKQEDPNTQQESVVRPFGMDAETSEADENKEKWVVWKRLRGGSGATAAAEIYDLAWSPDNRNI
VVACMDNSIRLFDVGAGMLVCGQSDHGHYVQGVAWDPLNQFILSQSADRSLHVYGVILSSAGVVTGLKLRSKIAKAELPC
PGDVLRTNYLFHNETLPSFFRRCSISPCGGLVVIPSGVYKVAGDEVANCVYVYTRSGILNSAGGVKNRPAIRIPSLKKPA
LMAAFSPVFYETCQKSVLKLPYKLVFAIATTNEVLVYDTDVLEPLCVVGNIHYSPITDLAWSEDGSTLLISSTDGFCSYV
SIDTETQFGSRIEPPAMHAEPLDTDESAVAAKNQREAGGIVNMLPVKKIPCNSSDSKKRRIHPTPVDL
Estimated Isoelectric Point:
5.91431427001953
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys25
Gln16
Leu40
Gly35
Met7
Ser41
Tyr14
His11
Glu23
Arg21
Cys10
Phe15
Pro24
Val42
Asn24
Ala36
Ile25
Trp8
Asp30