Sequence:
download
SGD:YLR419Wsequence.fasta
>YLR419W MAKKTKNNSKSSTPVNDVPTTAGKKKAKGKKGQEPEPEDDKRAKQQSNRAKVTSTASWTGKLPHTILHETCQKRKWNKVE YDMKKIGDKGFIAIAVLSFTDPKTKETLTARMNDPTYDKASGKGLVIPQETPIEARHMASTIALYRIAYNTNLHMMLPPN HRKTWYALDDFRKDNLKTDEKRINKLFDLDPFKTMVEDRKLKAQREKEQVAQNNQAQKEQVARTILSSHGGISSSGKDRQ ERKVASHKNSHNPSLVRFPKKVWENSIFVDLDESSRQLIETSLKEKIDWQAKKISHKNETIAENREDLKAKLLTLQFRPK HVEEAMLYKDPLSFLLFNLPEDDLPPFFHKKKGDTKNKVEITNLPLSTRMIVERLTEIGVSSDEALLALQQNDMNENEAA GFLTREILPTLNSNTNEPVSETESIECWNQELESLESIYEGCVMDAKEDSHYTLNLIEKLKIKLKVYRTKNYPASLPGIV VSTFDKNYKLPDYIKKQILTRLLHYLQEGNLIGDMLVYHIYEWLKENISKIIDNPGPLIPDSDSKGAINKRNISNGKRSI NNSSSRKFTKTTISEDTLSVLREEYTKRIKSSEYKSMQLVREQLPAWKKQKVIIDIINKNEVVLITGETGSGKSTQVVQF ILDFLQKEKGDFGKTKIVCTQPRRISAIGLAERVSDERCVTCGEEVGYVIRGVNKTKASTRIKFMTTGVLVRLLQNARTM LENTIVVIDEVHERSIDTDLIVTLMKNLLHRVRGMKIVLMSATVNVDLFKKFFPGLATCHIEGRTFPITDYFLEDILSDL DFKIKREKALSYDDDSVDERNNDDQYLKPRADSKFFTSGQINYDLLCQVVEYVHKRLKAANDNGSIIVFLPGVGEINKCC NLLANKSNEADFMVLPLHSALTPEDQKRVFKKYHGKRKVVVSTNIAETSITIDDCVATIDTGRAKSMFYNPKDNTTKLIE SFISKAEVKQRRGRAGRVREGLSYKLFSKNLYENDMISMPIPEIKRIPLESLYLSVKAMGIKDVKAFLSTALDAPPLPAL QKAERILTTIGLVDESDKSLTQLGQFISLMPVMDSKHGKLLIYGILFGCTDISVLLVSILGIGVLPFIGGFENREKIKKL LCKYESRGDLFAVLEIVRDYFKIKDSSIKRKYLRDNLLSYNKINEIKSSTAQYYSILKDVGFLPMDYKVGSISDLNRNER NFDILRAILTGAFYPHIARVQLPDVKYLSTSSGAVEKDPEAKMIKYWIRSEEYQDKLEEYKTKISQETQKVDLEDLPLPA TRAFIHPSSVLFSTNSVNLEDAKLLSEVDGPISRQSKIPTVVKYPFVLFTTSQVTNKLYLRDLTPTTTLSLLLFGGAISY DIGGTIHSPGIVVDNWLPIRTWCKNGVLIKELRTQLDEAIRKKLESPDYAKKSQIDNSGADKTLKIVEKIIASEQ
view sequence (1436 aa)
>YLR419W
MAKKTKNNSKSSTPVNDVPTTAGKKKAKGKKGQEPEPEDDKRAKQQSNRAKVTSTASWTGKLPHTILHETCQKRKWNKVE
YDMKKIGDKGFIAIAVLSFTDPKTKETLTARMNDPTYDKASGKGLVIPQETPIEARHMASTIALYRIAYNTNLHMMLPPN
HRKTWYALDDFRKDNLKTDEKRINKLFDLDPFKTMVEDRKLKAQREKEQVAQNNQAQKEQVARTILSSHGGISSSGKDRQ
ERKVASHKNSHNPSLVRFPKKVWENSIFVDLDESSRQLIETSLKEKIDWQAKKISHKNETIAENREDLKAKLLTLQFRPK
HVEEAMLYKDPLSFLLFNLPEDDLPPFFHKKKGDTKNKVEITNLPLSTRMIVERLTEIGVSSDEALLALQQNDMNENEAA
GFLTREILPTLNSNTNEPVSETESIECWNQELESLESIYEGCVMDAKEDSHYTLNLIEKLKIKLKVYRTKNYPASLPGIV
VSTFDKNYKLPDYIKKQILTRLLHYLQEGNLIGDMLVYHIYEWLKENISKIIDNPGPLIPDSDSKGAINKRNISNGKRSI
NNSSSRKFTKTTISEDTLSVLREEYTKRIKSSEYKSMQLVREQLPAWKKQKVIIDIINKNEVVLITGETGSGKSTQVVQF
ILDFLQKEKGDFGKTKIVCTQPRRISAIGLAERVSDERCVTCGEEVGYVIRGVNKTKASTRIKFMTTGVLVRLLQNARTM
LENTIVVIDEVHERSIDTDLIVTLMKNLLHRVRGMKIVLMSATVNVDLFKKFFPGLATCHIEGRTFPITDYFLEDILSDL
DFKIKREKALSYDDDSVDERNNDDQYLKPRADSKFFTSGQINYDLLCQVVEYVHKRLKAANDNGSIIVFLPGVGEINKCC
NLLANKSNEADFMVLPLHSALTPEDQKRVFKKYHGKRKVVVSTNIAETSITIDDCVATIDTGRAKSMFYNPKDNTTKLIE
SFISKAEVKQRRGRAGRVREGLSYKLFSKNLYENDMISMPIPEIKRIPLESLYLSVKAMGIKDVKAFLSTALDAPPLPAL
QKAERILTTIGLVDESDKSLTQLGQFISLMPVMDSKHGKLLIYGILFGCTDISVLLVSILGIGVLPFIGGFENREKIKKL
LCKYESRGDLFAVLEIVRDYFKIKDSSIKRKYLRDNLLSYNKINEIKSSTAQYYSILKDVGFLPMDYKVGSISDLNRNER
NFDILRAILTGAFYPHIARVQLPDVKYLSTSSGAVEKDPEAKMIKYWIRSEEYQDKLEEYKTKISQETQKVDLEDLPLPA
TRAFIHPSSVLFSTNSVNLEDAKLLSEVDGPISRQSKIPTVVKYPFVLFTTSQVTNKLYLRDLTPTTTLSLLLFGGAISY
DIGGTIHSPGIVVDNWLPIRTWCKNGVLIKELRTQLDEAIRKKLESPDYAKKSQIDNSGADKTLKIVEKIIASEQ
Estimated Isoelectric Point:
9.15818023681641
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr92
Lys151
Gln46
Leu145
Gly66
Met27
Ser108
Tyr45
His24
Glu97
Arg71
Cys14
Phe48
Pro59
Val86
Asn73
Ala71
Ile110
Trp11
Asp91