Sequence:
download
SGD:YLR255Csequence.fasta
>YLR255C MGVGGTRIVSFRQPNYYPVTQQKGASQTGAVAQPYSSYCGLLMRWAVVEIRRRGKGKGRKRKREREKGHTKFRIRRRSYL YFIRSCLVRPYSSGNKKNSCSFHKMLAIEIVLCLKAR
view sequence (118 aa)
>YLR255C
MGVGGTRIVSFRQPNYYPVTQQKGASQTGAVAQPYSSYCGLLMRWAVVEIRRRGKGKGRKRKREREKGHTKFRIRRRSYL
YFIRSCLVRPYSSGNKKNSCSFHKMLAIEIVLCLKAR
Estimated Isoelectric Point:
11.1665573120117
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr4
Lys11
Gln5
Leu7
Gly11
Met3
Ser10
Tyr7
His2
Glu4
Arg17
Cys4
Phe4
Pro4
Val8
Asn3
Ala6
Ile6
Trp1