Sequence:
download
SGD:YLR156Wsequence.fasta
>YLR156W MKFQYALAKEQLGSNSRSGVKKLISKHHWLPEYYFSDLSFSVVQQWDSRAIEKTTIISCMRPANQEIYPLRHCETLRSQP CSLFSSLYARSFQSSCTLHVAEPSPGFHMYGCHT
view sequence (115 aa)
>YLR156W
MKFQYALAKEQLGSNSRSGVKKLISKHHWLPEYYFSDLSFSVVQQWDSRAIEKTTIISCMRPANQEIYPLRHCETLRSQP
CSLFSSLYARSFQSSCTLHVAEPSPGFHMYGCHT
Estimated Isoelectric Point:
8.88282012939453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr5
Lys6
Gln7
Leu10
Gly4
Met3
Ser17
Tyr6
His6
Glu6
Arg6
Cys5
Phe6
Pro6
Val4
Asn2
Ala6
Ile5
Trp2
Asp2