Sequence:
download
SGD:YLR156C-Asequence.fasta
>YLR156C-A MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW
view sequence (44 aa)
>YLR156C-A
MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW
Estimated Isoelectric Point:
9.62462615966797
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys3
Gln1
Leu4
Gly3
Met1
Ser3
Tyr1
Glu1
Arg2
Cys1
Phe2
Pro2
Val2
Asn1
Ala5
Trp2
Asp1