Sequence:
download
SGD:YLR112Wsequence.fasta
>YLR112W MGGRSAQPRRFSFACRILHPAVAHDAMAGSRYILRAPASIIRLAQHGWLHCCLHFFLFPAMNDVCFVAKGSALYLFTVEI IVFGSPSLRHNVLSFFYFALPWFKRQCRLKVNFNRLKEIRGIAQVVRKAFFISKTLPCI
view sequence (140 aa)
>YLR112W
MGGRSAQPRRFSFACRILHPAVAHDAMAGSRYILRAPASIIRLAQHGWLHCCLHFFLFPAMNDVCFVAKGSALYLFTVEI
IVFGSPSLRHNVLSFFYFALPWFKRQCRLKVNFNRLKEIRGIAQVVRKAFFISKTLPCI
Estimated Isoelectric Point:
10.6987228393555
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr2
Lys6
Gln4
Leu14
Gly7
Met3
Ser9
Tyr3
His6
Glu2
Arg13
Cys6
Phe15
Pro7
Val9
Asn4
Ala15
Ile10
Trp2
Asp2