Sequence:
download
SGD:YLL053Csequence.fasta
>YLL053C MWFPQIIAGMAAGGAASAMTPGKVLFTNALGLGCSRSRGLFLEMFGTAVLCLTVLMTAVEKRETNFMAALPIGISLFMAH MALTGYTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLGAFLAWSVWQLLQILDYTTYVNAEKAAGQKKED
view sequence (153 aa)
>YLL053C
MWFPQIIAGMAAGGAASAMTPGKVLFTNALGLGCSRSRGLFLEMFGTAVLCLTVLMTAVEKRETNFMAALPIGISLFMAH
MALTGYTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLGAFLAWSVWQLLQILDYTTYVNAEKAAGQKKED
Estimated Isoelectric Point:
9.00244903564453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys5
Gln4
Leu18
Gly15
Met8
Ser7
Tyr6
His3
Glu5
Arg5
Cys2
Phe8
Pro6
Val8
Asn4
Ala23
Ile7
Trp5
Asp2