Sequence:
download
SGD:YIL111Wsequence.fasta
>COX5B MLRTSLTKGARLTGTRFVQTKALSKATLTDLPERWENMPNLEQKEIADNLTERQKLPWKTLNNEEIKAAWYISYGEWGPR RPVHGKGDVAFITKGVFLGLGISFGLFGLVRLLANPETPKTMNREWQLKSDEYLKSKNANPWGGYSQVQSK
view sequence (152 aa)
>COX5B
MLRTSLTKGARLTGTRFVQTKALSKATLTDLPERWENMPNLEQKEIADNLTERQKLPWKTLNNEEIKAAWYISYGEWGPR
RPVHGKGDVAFITKGVFLGLGISFGLFGLVRLLANPETPKTMNREWQLKSDEYLKSKNANPWGGYSQVQSK
Estimated Isoelectric Point:
9.79819488525391
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys14
Gln6
Leu18
Gly13
Met3
Ser8
Tyr4
His1
Glu11
Arg9
Phe5
Pro8
Val6
Asn9
Ala9
Ile5
Trp6
Asp4