Sequence:
download
SGD:YIL027Csequence.fasta
>EMC5 MSFVSKLLYTVSALVLFHSGFSSYEFHHLLKLNSLNNAQGAISKLPKDIMYETYAGLILFVLAVFTSFEKLQYLPIESND GKIISQGNYLKEIALNKATNVDNLIGSNPNGEIIFTPSFVDVHMKRKICREWASNTVKKEK
view sequence (142 aa)
>EMC5
MSFVSKLLYTVSALVLFHSGFSSYEFHHLLKLNSLNNAQGAISKLPKDIMYETYAGLILFVLAVFTSFEKLQYLPIESND
GKIISQGNYLKEIALNKATNVDNLIGSNPNGEIIFTPSFVDVHMKRKICREWASNTVKKEK
Estimated Isoelectric Point:
8.94690704345703
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys13
Gln3
Leu17
Gly7
Met3
Ser14
Tyr6
His4
Glu8
Arg2
Cys1
Phe9
Pro4
Val9
Asn11
Ala8
Ile11
Trp1
Asp4