Sequence:
download
SGD:YIL012Wsequence.fasta
>YIL012W MCLGKLYFEQLILVRCIKGRQSGNITTGESRCVSWNVYCTTSMIGLFSWRKMLLFQHFSYTQRENRQIGGKTWSLISSLF HLNETLASALHHPYETLALYEAYFALREKKFLL
view sequence (114 aa)
>YIL012W
MCLGKLYFEQLILVRCIKGRQSGNITTGESRCVSWNVYCTTSMIGLFSWRKMLLFQHFSYTQRENRQIGGKTWSLISSLF
HLNETLASALHHPYETLALYEAYFALREKKFLL
Estimated Isoelectric Point:
9.35492706298828
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys6
Gln5
Leu17
Gly7
Met3
Ser10
Tyr6
His4
Glu7
Arg7
Cys4
Phe7
Pro1
Val3
Asn4
Ala5
Ile6
Trp3