Sequence:
download
SGD:YHR180Wsequence.fasta
>YHR180W MEMHWITLVAFIATFFNLAATSINNSSLPDVDLTNPLRFFTNIPAGLNFNEVIFLERNGFYLGGIDSPSIYHLINGTAVY FGDVRDNIMPGTVGTTRNVTDVDYGSLLTEYGYEANTDYVSRWIATHVVISPLNATEFFQTPVPVPVPVPITILHQQVNS KLH
view sequence (164 aa)
>YHR180W
MEMHWITLVAFIATFFNLAATSINNSSLPDVDLTNPLRFFTNIPAGLNFNEVIFLERNGFYLGGIDSPSIYHLINGTAVY
FGDVRDNIMPGTVGTTRNVTDVDYGSLLTEYGYEANTDYVSRWIATHVVISPLNATEFFQTPVPVPVPVPITILHQQVNS
KLH
Estimated Isoelectric Point:
4.76726531982422
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys1
Gln3
Leu14
Gly10
Met3
Ser9
Tyr7
His5
Glu6
Arg5
Phe11
Pro11
Val16
Asn14
Ala9
Ile13
Trp2
Asp8