Sequence:
download
SGD:YHR125Wsequence.fasta
>YHR125W MINAIMIGSCQTFNTILCNISMNNYHSNVQLSSIRLQYCMKYSLTFSLFYNSTVTLKRQTWRTLIYDVCIWLDTAVIRNI IIRQLVVTLVVYYHMVCKNIT
view sequence (102 aa)
>YHR125W
MINAIMIGSCQTFNTILCNISMNNYHSNVQLSSIRLQYCMKYSLTFSLFYNSTVTLKRQTWRTLIYDVCIWLDTAVIRNI
IIRQLVVTLVVYYHMVCKNIT
Estimated Isoelectric Point:
9.30034637451172
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys3
Gln5
Leu10
Gly1
Met5
Ser8
Tyr7
His2
Arg5
Cys5
Phe3
Val9
Asn9
Ala2
Ile13
Trp2
Asp2