Sequence:
download
SGD:YHR053Csequence.fasta
>CUP1-1 MFSELINFQNEGHECQCQCGSCKNNEQCQKSCSCPTGCNSDDKCPCGNKSEETKKSCCSGK
view sequence (62 aa)
>CUP1-1
MFSELINFQNEGHECQCQCGSCKNNEQCQKSCSCPTGCNSDDKCPCGNKSEETKKSCCSGK
Estimated Isoelectric Point:
5.68082427978516
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr2
Lys7
Gln5
Leu1
Gly5
Met1
Ser8
His1
Glu6
Cys12
Phe2
Pro2
Asn6
Ile1
Asp2