Sequence:
download
SGD:YHL041Wsequence.fasta
>YHL041W MHLYSIAKSTTILRFLRHILLPFLHLSIHFTSCLCRIIYVGWKSFWKHFFFCGHKIKTPLFIASYAMFLAKQKIIVTMFE VSSVLEKLPQNILLFHYPLPSKMGNNLLMSFLTQRSIDEKEIDALLHPNAVYRFCNMRTTFRTLSSYGK
view sequence (150 aa)
>YHL041W
MHLYSIAKSTTILRFLRHILLPFLHLSIHFTSCLCRIIYVGWKSFWKHFFFCGHKIKTPLFIASYAMFLAKQKIIVTMFE
VSSVLEKLPQNILLFHYPLPSKMGNNLLMSFLTQRSIDEKEIDALLHPNAVYRFCNMRTTFRTLSSYGK
Estimated Isoelectric Point:
9.88770294189453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys11
Gln3
Leu21
Gly4
Met6
Ser13
Tyr6
His8
Glu4
Arg7
Cys4
Phe14
Pro6
Val5
Asn5
Ala6
Ile13
Trp2
Asp2