Sequence:
download
SGD:YGR288Wsequence.fasta
>MAL13 MTLTKQTCAKQACDCCRIRRVKCDGKRPCSSCLQNSLDCTYLQPSRKRGPKSIRLRSLKRIAEVQRESGPNTIATAPVIY KRVPKKLIDQCLRLYHDNLYVIWPLLSYDDLHKLLEEKYNDNYVYWFLTALSAATLSDLQTEIKSEEEVTFTGKQLSNLC ISSCQQFDDLDNSNIFNIMTYYCLHRSFAQISNARTSYRLCCEAVGLITVAGLHREETYGSLTFEEQQLRRKLYYLLLMT ERYYAIYLHCATSLDATIAPPQLELVTDPQLSMDSFLEMIRVFTVPGKCFFDALAADSTDASCTEESLKKIWNELHTTSS EIEPWSNGYIDISFSRHWIRILAWKLAYQMRGSNFSLNANNGQIPIEIARDMLIDTYLTPENLYDVHGPGVPVKTLEIAT ALVDIVGQYDHNMKLEAWNVLHDVCKFAFSLNHYNNDMLKRFSTKCQNALITLPISKPLQLDGYPKDNEDIDP
view sequence (474 aa)
>MAL13
MTLTKQTCAKQACDCCRIRRVKCDGKRPCSSCLQNSLDCTYLQPSRKRGPKSIRLRSLKRIAEVQRESGPNTIATAPVIY
KRVPKKLIDQCLRLYHDNLYVIWPLLSYDDLHKLLEEKYNDNYVYWFLTALSAATLSDLQTEIKSEEEVTFTGKQLSNLC
ISSCQQFDDLDNSNIFNIMTYYCLHRSFAQISNARTSYRLCCEAVGLITVAGLHREETYGSLTFEEQQLRRKLYYLLLMT
ERYYAIYLHCATSLDATIAPPQLELVTDPQLSMDSFLEMIRVFTVPGKCFFDALAADSTDASCTEESLKKIWNELHTTSS
EIEPWSNGYIDISFSRHWIRILAWKLAYQMRGSNFSLNANNGQIPIEIARDMLIDTYLTPENLYDVHGPGVPVKTLEIAT
ALVDIVGQYDHNMKLEAWNVLHDVCKFAFSLNHYNNDMLKRFSTKCQNALITLPISKPLQLDGYPKDNEDIDP
Estimated Isoelectric Point:
6.15335845947266
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys26
Gln20
Leu57
Gly15
Met9
Ser35
Tyr24
His11
Glu26
Arg25
Cys19
Phe15
Pro20
Val19
Asn24
Ala29
Ile31
Trp7
Asp30