Sequence:
download
SGD:YGR232Wsequence.fasta
>NAS6 MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIAC SVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLC GLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
view sequence (229 aa)
>NAS6
MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIAC
SVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLC
GLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
Estimated Isoelectric Point:
5.97615814208984
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr5
Lys19
Gln11
Leu30
Gly14
Met3
Ser15
Tyr5
His9
Glu14
Arg4
Cys4
Phe11
Pro9
Val18
Asn14
Ala16
Ile8
Trp5
Asp14