Sequence:
download
SGD:YGL081Wsequence.fasta
>YGL081W MGDIRTFVFAIEDTETTQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIKTPIPKIEGVPSIEQLRICIRDL NNKTGTVNLVSDGPNDEIDLKNGDAFGLIAIDNHPFRDNHHLAAKLIFRIELEYFDEAREIVKCTITNVTFGKNNTVSSF PIHSATSTEDSDSSWYGLSEASTQTEVADECHETNTILTRGGRFSILSLRKRGSKQDQKICSNFDRKIHETSSFEEEIEV CTDTDTTEEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIITPQHSNSMWLLLIVILIFDRLLSN
view sequence (321 aa)
>YGL081W
MGDIRTFVFAIEDTETTQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIKTPIPKIEGVPSIEQLRICIRDL
NNKTGTVNLVSDGPNDEIDLKNGDAFGLIAIDNHPFRDNHHLAAKLIFRIELEYFDEAREIVKCTITNVTFGKNNTVSSF
PIHSATSTEDSDSSWYGLSEASTQTEVADECHETNTILTRGGRFSILSLRKRGSKQDQKICSNFDRKIHETSSFEEEIEV
CTDTDTTEEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIITPQHSNSMWLLLIVILIFDRLLSN
Estimated Isoelectric Point:
5.00897979736328
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr28
Lys23
Gln8
Leu25
Gly16
Met2
Ser26
Tyr4
His8
Glu35
Arg17
Cys9
Phe15
Pro9
Val12
Asn17
Ala10
Ile32
Trp2
Asp22