Sequence:
download
SGD:YFL008Wsequence.fasta
>SMC1 MGRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRGVLNDENSDDYD NEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQ SPVELSRMFEEVSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKNELQKFQALW QLYHLEQQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKESAVISKQKSKLDYIFKDKEKLVSDLRLIKVPQQ AAGKRISHIEKRIESLQKDLQRQKTYVERFETQLKVVTRSKEAFEEEIKQSARNYDKFKLNENDLKTYNCLHEKYLTEGG SILEEKIAVLNNDKREIQEELERFNKRADISKRRITEELSITGEKLDTQLNDLRVSLNEKNALHTERLHELKKLQSDIES ANNQEYDLNFKLRETLVKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVI VENLTVAQECIAFLKKQRAGTASFIPLDTIETELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKD LKWKKGIRGKLVTIEGALIHKAGLMTGGISGDANNRWDKEEYQSLMSLKDKLLIQIDELSNGQRSNSIRAREVENSVSLL NSDIANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPKITELKKKLDDLENTKDNLVKEKEALQNNIFKEFTSKIGFTI KEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGSIESK LEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGIKEDIEKFDLERVTALKNCKISNINIPISSETTID DLPISSTDNEAITISNSIDINYKGLPKKYKENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETE QLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPL KRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDA LVGVYRQQQENSSKIITLDLSNYAE
view sequence (1226 aa)
>SMC1
MGRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRGVLNDENSDDYD
NEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQ
SPVELSRMFEEVSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKNELQKFQALW
QLYHLEQQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKESAVISKQKSKLDYIFKDKEKLVSDLRLIKVPQQ
AAGKRISHIEKRIESLQKDLQRQKTYVERFETQLKVVTRSKEAFEEEIKQSARNYDKFKLNENDLKTYNCLHEKYLTEGG
SILEEKIAVLNNDKREIQEELERFNKRADISKRRITEELSITGEKLDTQLNDLRVSLNEKNALHTERLHELKKLQSDIES
ANNQEYDLNFKLRETLVKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVI
VENLTVAQECIAFLKKQRAGTASFIPLDTIETELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKD
LKWKKGIRGKLVTIEGALIHKAGLMTGGISGDANNRWDKEEYQSLMSLKDKLLIQIDELSNGQRSNSIRAREVENSVSLL
NSDIANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPKITELKKKLDDLENTKDNLVKEKEALQNNIFKEFTSKIGFTI
KEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGSIESK
LEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGIKEDIEKFDLERVTALKNCKISNINIPISSETTID
DLPISSTDNEAITISNSIDINYKGLPKKYKENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETE
QLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPL
KRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDA
LVGVYRQQQENSSKIITLDLSNYAE
Estimated Isoelectric Point:
6.11084747314453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr53
Lys134
Gln62
Leu131
Gly49
Met17
Ser94
Tyr40
His18
Glu135
Arg60
Cys6
Phe39
Pro22
Val51
Asn86
Ala61
Ile94
Trp3
Asp70