Sequence:
download
SGD:YER028Csequence.fasta
>MIG3 MNYLRDRFPPDNDQRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRRRIKS KGSRKTVVNTATAAPTTFNENTGVSLTGIGQSKVPPILISVAQNCDDVNIRNTGNNNGIVETQAPAILVPVINIPNDPHP IPSSLSTTSITSIASVYPSTSPFQYLKSGFPEDPASTPYVHSSGSSLALGELSSNSSIFSKSRRNLAAMSGPDSLSSSKN QSSASLLSQTSHPSKSFSRPPTDLSPLRRIMPSVNTGDMEISRTVSVSSSSSSLTSVTYDDTAAKDMGMGIFFDRPPVTQ KACRSNHKYKVNAVSRGRQHERAQFHISGDDEDSNVHRQESRASNTSPNVSLPPIKSILRQIDNFNSAPSYFSK
view sequence (395 aa)
>MIG3
MNYLRDRFPPDNDQRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRRRIKS
KGSRKTVVNTATAAPTTFNENTGVSLTGIGQSKVPPILISVAQNCDDVNIRNTGNNNGIVETQAPAILVPVINIPNDPHP
IPSSLSTTSITSIASVYPSTSPFQYLKSGFPEDPASTPYVHSSGSSLALGELSSNSSIFSKSRRNLAAMSGPDSLSSSKN
QSSASLLSQTSHPSKSFSRPPTDLSPLRRIMPSVNTGDMEISRTVSVSSSSSSLTSVTYDDTAAKDMGMGIFFDRPPVTQ
KACRSNHKYKVNAVSRGRQHERAQFHISGDDEDSNVHRQESRASNTSPNVSLPPIKSILRQIDNFNSAPSYFSK
Estimated Isoelectric Point:
9.95819854736328
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr28
Lys21
Gln14
Leu21
Gly20
Met6
Ser65
Tyr7
His14
Glu12
Arg30
Cys6
Phe14
Pro31
Val22
Asn24
Ala19
Ile21
Asp19