Sequence:
download
SGD:YDR344Csequence.fasta
>YDR344C MAFLSWTFFPSFFHFLERNRFFLTFATQLHYLNPFYILSFRVEWHQIWENLAYSDTNTFFHEYCWKIFPCLSAGIRNNGC CDAAKGQGKNKQHTPKQEEEIPNTSLRRHRSCCNMFTCSSPCYYLEINVGVIGVRRPVLSEEQRKNC
view sequence (148 aa)
>YDR344C
MAFLSWTFFPSFFHFLERNRFFLTFATQLHYLNPFYILSFRVEWHQIWENLAYSDTNTFFHEYCWKIFPCLSAGIRNNGC
CDAAKGQGKNKQHTPKQEEEIPNTSLRRHRSCCNMFTCSSPCYYLEINVGVIGVRRPVLSEEQRKNC
Estimated Isoelectric Point:
8.60254669189453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys6
Gln6
Leu11
Gly6
Met2
Ser10
Tyr6
His6
Glu10
Arg10
Cys9
Phe15
Pro7
Val5
Asn11
Ala6
Ile7
Trp4
Asp2