Sequence:
download
SGD:YDR157Wsequence.fasta
>YDR157W MSETCSSSLALLHKILHIHSHTPSVYYNICISVRILTSERLQCFFFSFFPDPNITGSGLKVPGFLFFHTFFFSKSCCQAL IDSFSSDYYQFKMLEKNRKAEKINKRTIFICSFTFEYKIKSCFSCFHLSTHTN
view sequence (134 aa)
>YDR157W
MSETCSSSLALLHKILHIHSHTPSVYYNICISVRILTSERLQCFFFSFFPDPNITGSGLKVPGFLFFHTFFFSKSCCQAL
IDSFSSDYYQFKMLEKNRKAEKINKRTIFICSFTFEYKIKSCFSCFHLSTHTN
Estimated Isoelectric Point:
8.95246124267578
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys10
Gln3
Leu11
Gly3
Met2
Ser19
Tyr5
His7
Glu5
Arg4
Cys8
Phe18
Pro4
Val3
Asn5
Ala3
Ile11
Asp3