Sequence:
download
SGD:YDR134Csequence.fasta
>YDR134C MQFSTVASIAAIAAVASAASNITTATVTEESTTLVTITSCEDHVCSETVSPALVSTATVTVNDVITTQQGSSTQTVTSYT GAAVKALPAAGALLAGAAALLL
view sequence (137 aa)
>YDR134C
MQFSTVASIAAIAAVASAASNITTATVTEESTTLVTITSCEDHVCSETVSPALVSTATVTVNDVITTQQGSSTQTVTSYT
GAAVKALPAAGALLAGAAALLL
Estimated Isoelectric Point:
4.07534027099609
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys1
Gln4
Leu8
Gly4
Met1
Ser12
Tyr1
His1
Glu4
Cys2
Phe1
Pro2
Val12
Asn2
Ala21
Ile5
Asp2