Sequence:
download
SGD:YDR102Csequence.fasta
>YDR102C MTLLLQKCIRVELRKDPIFNASSSLEIFLSVLESVIYPFKGNLILLDFHLVDVQTTCYQRNSSMRNQLMSVFCQSLREFT LTALSCNSYCIIIVATRWQKIDNALKMTGR
view sequence (111 aa)
>YDR102C
MTLLLQKCIRVELRKDPIFNASSSLEIFLSVLESVIYPFKGNLILLDFHLVDVQTTCYQRNSSMRNQLMSVFCQSLREFT
LTALSCNSYCIIIVATRWQKIDNALKMTGR
Estimated Isoelectric Point:
8.94893646240234
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys5
Gln6
Leu16
Gly2
Met4
Ser11
Tyr3
His1
Glu4
Arg7
Cys5
Phe6
Pro2
Val7
Asn6
Ala4
Ile9
Trp1
Asp4