Sequence:
download
SGD:YDL178Wsequence.fasta
>DLD2 MLRNILVRSTGSNFKFAGRYMKSSALLGYYRRVNYYSTKIQTRLTSENYPDVHRDPRFKKLTSDDLNYFKSILSEQEILR ASESEDLSFYNEDWMRKYKGQSKLVLRPKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGGSVPIFDELILSLANLNKIRD FDPVSGILKCDAGVILENANNYVMEQNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNS MHSMRKDNTGYDLKQLFIGSEGTIGIITGVSILTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSEILSAFEFMDAKSQ VLAKSQLKDAAFPLEDEHPFYILIETSGSNKDHDDSKLETFLENVMEEGIVTDGVVAQDETELQNLWKWREMIPEASQAN GGVYKYDVSLPLKDLYSLVEATNARLSEAELVGDSPKPVVGAIGYGHVGDGNLHLNVAVREYNKNIEKTLEPFVYEFVSS KHGSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVHYDPNGILNPYKYI
view sequence (531 aa)
>DLD2
MLRNILVRSTGSNFKFAGRYMKSSALLGYYRRVNYYSTKIQTRLTSENYPDVHRDPRFKKLTSDDLNYFKSILSEQEILR
ASESEDLSFYNEDWMRKYKGQSKLVLRPKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGGSVPIFDELILSLANLNKIRD
FDPVSGILKCDAGVILENANNYVMEQNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNS
MHSMRKDNTGYDLKQLFIGSEGTIGIITGVSILTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSEILSAFEFMDAKSQ
VLAKSQLKDAAFPLEDEHPFYILIETSGSNKDHDDSKLETFLENVMEEGIVTDGVVAQDETELQNLWKWREMIPEASQAN
GGVYKYDVSLPLKDLYSLVEATNARLSEAELVGDSPKPVVGAIGYGHVGDGNLHLNVAVREYNKNIEKTLEPFVYEFVSS
KHGSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVHYDPNGILNPYKYI
Estimated Isoelectric Point:
5.77652740478516
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys39
Gln15
Leu55
Gly42
Met13
Ser46
Tyr27
His11
Glu39
Arg20
Cys3
Phe20
Pro20
Val46
Asn32
Ala26
Ile27
Trp3
Asp29