Sequence:
download
SGD:YDL177Csequence.fasta
>YDL177C MSKNVGKLVKIWNESEVLVDRKSKFQARCCPLQNQKDIPSILQELTQNNKSVSKASHMHMYAWRTAEVSNNLHLQQEQKK KGNKANKSNNSHVNKSRNITVQPKNIEQGCADCGEAGAGQRLLTLLERANIFNVLVIVTRWYGGTPLGSSRFRHISTCAV ETLKKGGFLP
view sequence (171 aa)
>YDL177C
MSKNVGKLVKIWNESEVLVDRKSKFQARCCPLQNQKDIPSILQELTQNNKSVSKASHMHMYAWRTAEVSNNLHLQQEQKK
KGNKANKSNNSHVNKSRNITVQPKNIEQGCADCGEAGAGQRLLTLLERANIFNVLVIVTRWYGGTPLGSSRFRHISTCAV
ETLKKGGFLP
Estimated Isoelectric Point:
9.90650177001953
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys17
Gln11
Leu15
Gly11
Met3
Ser14
Tyr2
His5
Glu9
Arg9
Cys5
Phe4
Pro5
Val12
Asn16
Ala10
Ile8
Trp3
Asp3