Sequence:
download
SGD:YBR297Wsequence.fasta
>MAL33 MTLVKYACDYCRVRRVKCDGKKPCSRCIEHNFDCTYQQPLKKRGSKPIGTRSLKYIPKAKMFIDNKSCTAAAEILMKVPK KVIDQCLRLYHDNLYVIWPLLSYDDLHKLLDEEYNDHYVYWFLVALSAANLSDLQSELESEGGFSFTGKQLAVLCMSSRQ QFDDLSGRDIFRIMTYYCLLRCFSQSSDVRNSYRLCREAIGLVIVAGLHREKAYESLSFREQQLLRKVYYLLLLTERYYS VYVHCVTSLDTTIAPPQPEFVTDPRLSLDSFFEMIRVFTVPGKCFFDALATESTSGSCTEDSLKKIWKELHTASLEIEPW SYGYVDISFSRHWIRALAWKLVFQMNGTKFFSNANNAHILVEIAKDMLDDIFLTPNNLYDVHGPGIPMKSLEVANALVDI VNKYDHNMKLEAWNILCDVSKFVFSLKHCNHKMFQRFSTKCQSALIDLPISRPLRLNDDSKDEDDIIP
view sequence (469 aa)
>MAL33
MTLVKYACDYCRVRRVKCDGKKPCSRCIEHNFDCTYQQPLKKRGSKPIGTRSLKYIPKAKMFIDNKSCTAAAEILMKVPK
KVIDQCLRLYHDNLYVIWPLLSYDDLHKLLDEEYNDHYVYWFLVALSAANLSDLQSELESEGGFSFTGKQLAVLCMSSRQ
QFDDLSGRDIFRIMTYYCLLRCFSQSSDVRNSYRLCREAIGLVIVAGLHREKAYESLSFREQQLLRKVYYLLLLTERYYS
VYVHCVTSLDTTIAPPQPEFVTDPRLSLDSFFEMIRVFTVPGKCFFDALATESTSGSCTEDSLKKIWKELHTASLEIEPW
SYGYVDISFSRHWIRALAWKLVFQMNGTKFFSNANNAHILVEIAKDMLDDIFLTPNNLYDVHGPGIPMKSLEVANALVDI
VNKYDHNMKLEAWNILCDVSKFVFSLKHCNHKMFQRFSTKCQSALIDLPISRPLRLNDDSKDEDDIIP
Estimated Isoelectric Point:
7.47472381591797
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys33
Gln14
Leu54
Gly15
Met11
Ser39
Tyr23
His13
Glu23
Arg25
Cys18
Phe24
Pro18
Val28
Asn18
Ala25
Ile27
Trp7
Asp34